KEGG   Pedobacter cryoconitis: AY601_0434Help
Entry
AY601_0434        CDS       T04341                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pcm  Pedobacter cryoconitis
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pcm00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    AY601_0434
Enzymes [BR:pcm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     AY601_0434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
490416..491297
Genome map
AA seq 293 aa AA seqDB search
MNLLFDQIKLGKKRRLLEAHSAISAMIVENSSIYDKNGEKKEFDGVWVSSLTLSLSKGLP
DIELVDITSKLNLIQEIRRISNKPIIVDCDTGSLKEQFGFIVNALERGGVSAIVIEDKFG
YKQNSLIEENENQKQESVENFCDKIRIGVRAMQHDTIGIVARIESFILGKGLDDALFRAK
AYINAGASGILIHSKDKSADKVIEFAKVFKVDFPNIPLFCVPSKFNSIADEELFSSGFDV
VIHANHLLRAAYPAMLNTAKSILQFDRSYEAGTDIMEINDILSLIPDPNVMPI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaatctattatttgatcagattaaattaggaaagaaaagacggctacttgaggcccat
tctgctatttcagcaatgattgttgaaaattcttcaatctatgataagaatggcgagaaa
aaggaatttgatggcgtatgggttagcagcttaacgctttcactaagtaaagggctaccg
gatattgagttggttgatataactagtaaacttaatctcattcaagaaataagacgtatt
tctaataagcctataattgttgactgtgatactggttcgctcaaggagcaatttggtttt
atagttaatgccttagaaagaggtggagtttctgcaattgtaattgaagataaatttggt
tataaacaaaattctttaatcgaagaaaatgagaatcaaaagcaagagtctgttgaaaat
ttttgtgataaaatcagaataggagttagagcaatgcaacatgatacgataggaatcgtc
gccagaatagaaagttttattttagggaagggacttgatgacgcactctttagggcaaaa
gcctatatcaatgctggtgcatctggaattttgatccatagcaaagataaatcagcggat
aaggtgattgaatttgcaaaagtatttaaagttgatttccctaatattcctcttttttgt
gttccttctaaatttaactctatagctgatgaggagctttttagttcgggttttgatgtt
gtaatccatgcaaatcatttattaagagctgcatatccagcgatgttaaataccgctaaa
agtattctgcaatttgacagatcatatgaagcgggtactgatattatggagatcaatgat
atattaagccttattcctgaccctaatgtgatgccgatataa

DBGET integrated database retrieval system