KEGG   Pedobacter cryoconitis: AY601_4695Help
Entry
AY601_4695        CDS       T04341                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pcm  Pedobacter cryoconitis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AY601_4695
  Amino acid metabolism
   00310 Lysine degradation
    AY601_4695
   00380 Tryptophan metabolism
    AY601_4695
Enzymes [BR:pcm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AY601_4695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5478090..5480885
Genome map
AA seq 931 aa AA seqDB search
MDNLSYLNGANAEYIDSIYQAYKEDPNAVEFGWQKFFEGFDFGRGADAGVASEATPEHFL
KEVSVLNLINGYRQRGHLFTQTNPVRERRHHLPTLDIENFGLSQADLDTVFNSSVELGIG
AAKLSDIVTFLKRTYCRSIGAEYKFVRTPEVLSWIENKMESVQNTPNFSIEEKRRILKKL
NEAVSFENFLGTKFLGQKRFSLEGAEALIPALDSVIEKGSAMGIEEFVIGMAHRGRLNVL
ANIMQKTYKDIFAEFEGKGYSAESPFGGDVKYHLGYSTDVTTNDGKSVHLSLCPNPSHLE
TVNGVVEGMTRSKIDFKYGGDDSRIAPILIHGDASVAGQGIVYEVIQMAGLDGYKTGGTI
HLVINNQIGFTTNYKDGRTSTYCTDIAKVTLSPVFHVNGDDVEALVYAINLAMEYRQKYK
NDVFIDILCYRRFGHNEADEPKFTQPLLYKSIEQHANPRDIYIKQLIGEGKMEASLAKEM
EVEFRGILQERLNEAKEVTSTYKGVKFAGAWSDMRIASAEDFVTSPDTSVKKTTLLEIAK
RISTLPADKKFFKKIEKLFAERNKMATSSHVFDWAMGEQLAYATLLTEGKRVRLSGQDVE
RGTFSHRHAVLTLEDSEEEYIPLSNLSDQQAPFDIYNSHLSEYGVLGFEYGYAMANPNAL
TIWEAQFGDFFNGAQIVVDQYIASAETKWQRENGLVMLLPHGYEGQGPEHSSARIERFME
LCADYNMQVTNCTTPANFFHAIRRQFKRDFRKPLIVFTPKSLLRHPLCVSKLEEFTNGKF
QEVINDANVKANEVDRVLFCSGKIYYELLEKQQKEEIKNVAIVRVEQLYPTPFKQMEEVY
KGYKNAKEAVWVQEEPENMGAWPYLLRKTRKTVFSDIEVISRKESSSTATGFAKQHADEQ
AYILAKSFAAPVTEVDQKIAKKSVSKAYNVD
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggataatttatcttatctcaacggcgcaaatgccgaatacatcgattctatttatcaa
gcttataaagaagatcctaatgcggttgaattcggctggcagaagttttttgaagggttt
gattttggaagaggagcggatgctggcgtagccagtgaagcaactcccgaacatttttta
aaagaagtgagtgtcttaaatctgatcaatggttatcgccagcgcggtcatttgtttacc
caaacaaatccggtaagagaaagacgtcatcatttaccaactcttgatatcgaaaacttt
ggtttgagtcaggctgacctggacaccgtttttaattcgagcgtagaacttggtattggt
gctgccaaactaagcgatatcgtaacctttctgaagagaacttactgcaggtctattggt
gcggaatataaatttgtccgtacacctgaagtattaagctggattgaaaataaaatggaa
agtgtgcagaacacgccaaatttttcaattgaagagaaaagaaggatccttaaaaagtta
aatgaagcggtaagctttgagaacttcttaggaactaagtttcttggtcagaagagattt
tctttagaaggggctgaggctttaattcctgcactggattcagtaattgaaaaaggttct
gcaatgggaattgaagaatttgtaattggtatggcacacagagggcgtttaaatgtgctg
gccaatatcatgcaaaaaacttacaaagatatctttgctgaatttgaaggtaagggctac
agtgcggaatctccttttggaggtgatgtgaagtaccaccttggttattctacggatgta
actacgaatgacggaaaaagcgtccatttgagtttatgtcctaacccatctcacctggaa
acagtaaatggtgtggttgaaggaatgacacgttctaaaatcgatttcaaatatggtggg
gatgattcacgtattgcgcctatcctgattcatggtgacgcttcggttgccggacagggg
atcgtttacgaagttattcaaatggcaggtctggatggttataaaaccggtggtacgatc
cacctggtgattaacaaccagattggttttactacaaattataaagacggccgtaccagt
acctattgtacagatattgctaaggtgacgctttctcctgttttccatgtgaatggagat
gatgtagaagctttggtttatgcgatcaacctggctatggaataccgtcagaaatataaa
aatgatgttttcatagatattctgtgttaccgcagattcgggcataatgaagcagatgag
cctaaattcactcagcctttattgtacaaaagcatcgagcagcatgctaatccaagagat
atctatatcaaacaactgattggtgaaggtaaaatggaagcaagcctggcaaaagaaatg
gaagttgaattccgtggtattttacaggagcggttaaatgaagcgaaagaagttacttct
acttataagggagtgaaatttgctggtgcatggtcagacatgagaattgccagtgcagaa
gattttgttacttctcctgatacgtctgttaaaaagactactttattagagattgcaaaa
aggattagtactttgcctgcagataaaaagttcttcaagaaaattgagaaactatttgct
gagcgtaataaaatggctacttcaagtcatgtttttgactgggcaatgggtgagcagctg
gcttatgcaactttacttactgaaggtaagagagttcgtttaagcggacaggatgtagag
cgtggtacattctcacatcgtcatgctgttttaactttagaagattctgaagaggaatat
atccctttaagtaacctttctgatcagcaggccccatttgatatctataattcacattta
tctgaatatggcgttttagggtttgagtatggttatgcaatggcaaaccctaatgcttta
actatttgggaagcgcagtttggtgatttctttaatggtgcacaaattgttgtggatcaa
tatattgcaagtgcagaaacaaaatggcagcgtgaaaacgggttagttatgttattgcct
catggttatgaaggacaagggcctgaacactcttctgcaaggattgagcgttttatggaa
ctttgtgcggattacaatatgcaggtaactaactgtactactcctgctaactttttccat
gcaatccgtcgtcagtttaaacgtgatttcagaaaaccattaattgtttttacccctaaa
agcttattgcgtcatcctttatgtgtttctaagctggaagaatttactaatggaaaattc
caggaggtaatcaatgatgcaaatgttaaagcgaatgaggtagacagagtattgttctgc
agtggtaaaatttactacgaattgttagagaaacaacagaaagaggagatcaaaaatgtt
gcgatcgttcgtgttgagcagttatatcctacgccatttaaacaaatggaagaagtttat
aaaggttataaaaatgcgaaagaagctgtttgggttcaggaagaacctgaaaacatgggt
gcatggccttatttgttgcgtaaaacaagaaagacagtatttagtgatattgaagtgatt
tcaagaaaagaaagcagcagtactgcaactggatttgcgaaacagcatgcggatgagcaa
gcttatattctggcaaaatcttttgcagcacctgtaactgaggtggatcagaaaattgct
aagaaatcagtgagtaaagcatataacgtagattag

DBGET integrated database retrieval system