KEGG   Phanerochaete carnosa: PHACADRAFT_187812Help
Entry
PHACADRAFT_187812 CDS       T03128                                 

Definition
(RefSeq) glycosyltransferase family 3 protein
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
pco  Phanerochaete carnosa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pco00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PHACADRAFT_187812
Enzymes [BR:pco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PHACADRAFT_187812
Glycosyltransferases [BR:pco01003]
 Polysaccharide
  Storage polysaccharide
   PHACADRAFT_187812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 1090 aa AA seqDB search
MRVPHLKTLADLSPKQIDRVLTHARYLKQVSMPWLLPQQHNSNNKLRMPSQSLFSKSIAL
LFSKRSTRTRVAAETAATLLGGRALFLGREDIQLGVNESTRDSARVIGGMCQGIFARVGA
HEEIEELANYSPVPVLNALSSLWHPTQVLADLLTLQENAHLFDPSVEPLVSDPHQFASAK
QFYPLPKLRPLTVAYVGDSANVLHDMLVSFPRLGHKLRVASPEDEKYRAPKAVWDRVVEL
GCDKDIWWGKDPKEAVNGADLVVTDTWISMGQEAEKAERLKAFEGYQVTEALCREGGANP
EWRFMHCLPRKQDEVDDEVFYGPRSLVFPVSDNRKWTIMALFEPRAPPRTTTMSDGEVKR
DVRSPLLFECAWEVANKVGGIYTVIKTKVPVTVSEFGDRYCLIGPLSYKTAPMEVEAQEP
HDPHLAGTLDAMRSAGVKCLYGRWLVEGAPRVLLFDTGSQYSRLDEWKGDLWNLAGIPTP
PNDHETNETIIFGYIVAWFLGEYVSRQLSTAVIAHFHEWQAGLAIPLLRKRHVDVTTVFT
THATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSSAHCADVFTTVSHITA
YESEHLLKRKPDGVLPNGLNVVKFQAMHEFQNLHSAAKEKINEFVRGHFYGHFDLDLENT
LYARISGSHTLWNKGVDMFIEGLARLNYRLKKAGSKTTVVAFIIMPAPTHSYTVDALKGQ
AVTKQLRDTVTEIQNKIGKRLFDHAMRSNGEHATLPTPDDLLSDEDKVLLKRRIFALKRN
ALPPITTHNMADDHNDPVLNQIRRVQLFNSESDRTKVVFHPDFLNSNNPILGMDYEEFVR
GCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCFMQDIIERPQDEGCYIIDRRSQ
SVEDSVNQLTDHMFSFATKTRRQRINQRNRVERLSPLLDWKNLGIEYSKARQLALRRAYP
DAFYGGEEDEQFEFSGPERMMPHSVPASPRFRTSGFATPGDIGTITEEMQGLSTSDYRGY
PWPAGAEDEEEGYPFPLVMKVRSRASSIMSGASTPGGGKSNSLSEGDLRKADAALSHVHD
YQANGVNGKH
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtaccccatttaaagactctagctgacctcagccccaagcaaattgaccgagtt
ctcacccacgctcggtacctcaagcaggtgtcaatgccatggctcttaccacagcagcat
aactcgaacaataagctgcgcatgccatctcaatcgctcttcagcaaatctatcgcgttg
ctgttctcaaaacgcagtactcgtacccgtgttgcggcggaaacggccgcgacgttactt
ggagggcgtgcactgttcctcggacgagaggacatccagctcggcgtgaacgaaagcacg
cgtgactctgcgcgagtcattggaggcatgtgccagggtatttttgctcgtgttggtgca
cacgaagagattgaggaattggcgaattattcgcctgtccctgtgctaaacgctctatca
tcactgtggcacccaacacaagtcttggcggaccttctaacgttgcaagagaacgcacac
ttattcgacccaagcgtagagccacttgtgtcagacccacatcagttcgccagtgccaag
cagttttacccgctacccaagctacgcccgctcactgttgcctacgtcggtgactctgcg
aacgtccttcatgatatgctcgtatcctttcctcggctcggtcacaaacttcgcgttgcg
tctccggaagatgagaaataccgggcaccgaaggcagtttgggaccgtgttgtcgagctg
gggtgcgataaggatatctggtggggtaaggaccccaaggaggctgtcaatggcgcagat
cttgttgtgactgacacttggatatccatgggtcaggaagctgaaaaagccgaacgtctg
aaggcatttgaaggatatcaggtcaccgaagctctttgtcgtgaaggtggtgcaaatcct
gaatggagattcatgcactgcctgccccgcaagcaggacgaggtggacgacgaggtcttc
tacggtccacgttcactcgtgttcccagtgtcagataatcgaaagtggactattatggca
ctgtttgaaccgcgcgcgccaccacgaacgacgaccatgtcagacggagaggtcaagcga
gatgtcagaagccccttgctctttgaatgtgcttgggaagtcgcgaacaaagtcgggggt
atctacaccgtcatcaagaccaaggtcccagttaccgtctccgagtttggcgatagatac
tgcctcataggtccgctgagctacaagacggcgccgatggaggtcgaagcgcaagagccc
cacgatccccaccttgctggtactttggacgcgatgcgtagcgctggagtaaagtgtctc
tatggtcgatggctagttgaaggagctcctcgggtccttctcttcgataccggcagccag
tactcacgactcgatgagtggaaaggcgatctgtggaacctcgcaggcattccgacgcca
cccaacgatcatgaaaccaatgagacgatcatatttggatacatagtagcgtggttcctg
ggcgagtacgtctcgcgccagctgtcgactgccgtcatcgctcacttccacgaatggcag
gcgggtctcgcgattcctctgttacgcaagcgtcacgtcgacgtcacgacggtctttacg
acccacgctacattacttggccgctacctctgcgcgggcagcgttgacttctataacaac
ttgcagtactttgacgttgatcatgaagccgggaagcgcggcatctaccatcgatactgc
atcgagagatcttcggctcactgcgccgacgttttcacgacagtctcccatatcaccgcg
tacgaatccgagcacttgctcaagcggaagccggatggtgtcttaccgaatggcctcaat
gttgtgaagttccaagcgatgcacgagttccaaaacctgcactcggcagcgaaggagaag
attaacgaattcgttcgcgggcacttctatggtcatttcgaccttgatctagaaaacacg
ctatacgcacgtatttccggatcgcatacgctctggaacaaaggcgtagatatgtttatt
gagggtctcgcacggctcaactatcgactaaagaaggctggctcgaagaccacagttgtg
gcattcattatcatgccggctccgacacattcatacaccgtcgatgcactcaaggggcag
gctgttaccaagcagctgcgcgacactgtcaccgagatccagaataagattggtaaacgg
ttatttgaccatgctatgcgttctaatggggagcatgctaccttgccgacacctgacgac
ctgctatcggatgaggacaaggtcttactcaagcgtcgcatttttgctctcaaacgcaat
gcgcttcctcctatcactacccacaacatggctgatgaccacaacgaccctgtcctgaac
cagatccgccgcgtacagctcttcaactcagaatcagaccgtacaaaggtcgtcttccac
cctgacttcctgaactccaacaatcctatcctcggtatggactacgaggagttcgttcgc
ggttgccacctcggcgtcttcccctcgtattatgaaccatggggttacactcctgcggag
tgtacggtgatgggtatcccttcgatcacgaccaacctatccggctttggctgcttcatg
caagacatcatcgaacgtcctcaggacgagggctgctacattattgataggcgcagccaa
tctgtcgaagactctgttaaccaactcacagatcacatgttctccttcgccaccaagacg
cgccgacagcgtatcaaccagcgcaaccgcgtcgaacgtcttagcccactcctcgattgg
aagaacctcggtattgaatattcgaaagctcgacagctcgccttgcgtcgtgcgtatccg
gacgcattctacggcggcgaggaggacgaacagttcgagtttagtggtccggagcgtatg
atgccgcactccgtgcctgctagccctaggtttagaacctcgggctttgcgacacccggc
gacattggtactatcacggaagagatgcaagggctgtcaaccagcgactaccgcggctac
ccatggcccgccggcgcggaagatgaggaggaaggctatcctttcccactggtaatgaag
gtacgctcgcgtgccagctcaatcatgtctggcgcgagtacgcctggcggcggcaagtcc
aacagtctcagtgagggtgacctgcgcaaggcggatgctgcactcagccatgttcacgac
tatcaggcgaatggtgtgaatggcaaacattga

DBGET integrated database retrieval system