KEGG   Paracoccus contaminans: B0A89_02225Help
Entry
B0A89_02225       CDS       T04876                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pcon  Paracoccus contaminans
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pcon00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    B0A89_02225
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B0A89_02225
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    B0A89_02225
Enzymes [BR:pcon01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B0A89_02225
Peptidoglycan biosynthesis and degradation proteins [BR:pcon01011]
 Precursor biosynthesis
  Amino acid ligase
   B0A89_02225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(465851..466957)
Genome map
AA seq 368 aa AA seqDB search
MRRNPVDRWPKPAAPRAKALFPWRALWLEWRNHRACCKAARNDGETPNQSRPTGRKADVT
GRSSRTAHTVAVLMGGPSAEREVSLSSGRGCADALRVAGFEVAEIVLGPGDGAGLAARLA
EARPDVVFNALHGRLGEDGCVQGLLEWMGLPYTHSGVLASALAMDKTRAKQAFRDAGLPV
AHSVIASREEVRAGHVLPPPYVVKPNDEGSSVGVFIVREGDNAAPLPDSMPAQVMVETYA
PGRELTTAVLGDRPLGVTEIVTAGWYDYDAKYAAGGSRHIIPADIPADVAQACLDYALRA
HQALGCRGLSRTDFRWDDRRGADGLIVLETNTQPGMTPTSLAPEQAAFAGIAFPELCRWM
VEDALCRD
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcgccggaatcctgtggacagatggccgaaacctgccgcgccgcgtgcgaaggccctt
ttcccgtggcgcgctctgtggctagaatggcgcaaccaccgggcgtgctgcaaggctgcc
cggaacgacggggaaaccccgaaccagtcccggccaaccgggcgaaaggcagatgtgacg
ggcaggtcgagcaggacagcccacaccgtagcggtcctgatgggcggcccctcggctgag
cgcgaggtatcgctgtcgtcggggcgcggatgcgcggatgcgctgcgggtggcgggattt
gaggtggccgagatcgttcttggccccggcgatggcgccggtctggcggcgcggctggcc
gaggcgcgccccgatgtcgtcttcaacgccctgcatggccgcctgggcgaggatggctgc
gttcagggcctgctggaatggatggggctgccctatacccattcgggtgtgctcgcctcg
gctctggcgatggacaagacgcgcgccaagcaggcgttcagggatgccggcctgccggtt
gcccacagcgtgatcgccagccgcgaggaggtgcgcgccggccatgtcctgcccccgccc
tatgtggtcaagcccaatgacgagggctcctcggtcggggtgttcatcgtgcgcgagggc
gacaacgccgcgccgctgcccgattcgatgcccgcgcaggtcatggtcgagacctatgcg
ccgggtcgcgagctgaccaccgccgttctgggcgaccgccccctgggcgtcaccgagatc
gtgacggcgggctggtacgactatgacgccaaatatgccgcgggcggatcgcgccacatc
atcccggccgacattcccgccgatgtggcgcaagcctgccttgactatgccttgcgcgcg
catcaggcgctgggctgccgcgggctgtcgcggaccgatttccgctgggacgaccggcgc
ggggcggacgggctgatcgtgctggaaaccaacacccagccgggcatgacgccgacctcg
ctcgcgcccgaacaggcggcctttgccggcatcgcctttcccgagctgtgccgctggatg
gtcgaggacgcgctatgcagggactga

DBGET integrated database retrieval system