KEGG   Paracoccus contaminans: B0A89_04975Help
Entry
B0A89_04975       CDS       T04876                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pcon  Paracoccus contaminans
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcon00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B0A89_04975
   00650 Butanoate metabolism
    B0A89_04975
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B0A89_04975
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B0A89_04975
Enzymes [BR:pcon01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B0A89_04975
Amino acid related enzymes [BR:pcon01007]
 Aminotransferase (transaminase)
  Class III
   B0A89_04975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1037895..1039220)
Genome map
AA seq 441 aa AA seqDB search
MTTMTDRKNAAISRGVGMTTQIYADRAENAEIWDKDGNRYIDFAAGIAVVNTGHRHPRVV
QAVKDQLDRFTHTCHQVVPYENYVSLAERLNALVPGDFEKKTIFATTGAEAVENAVKIAR
YATNRSAIVAFTGAFHGRTFMGMTLTGKVQPYKAGFGAMMPDVYHLPFPNDLHGVTQDDA
LAALDKLFKADVDPKRVAAIIVEPVQGEGGFYPVPSGFMQKLRSLCDDHGMLLIADEVQT
GFARTGKLFAMEHHGVAADITTMAKGLGGGLPISAVTGRAEVMDAPNPGGLGGTYAGNPL
GVAAAHAVLDVIEEEGLAERAERLGQRLKQRLASLRDDVPEIIDIRGPGLMNAVEFNVAG
TEKPSPDFTNKVREEALSRGLILLTCGVYGNVIRFLPPLTVPDAVFDEALDILEASVRAA
RGAGGKAPAIDGNAGPGQQEA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgatgaccgaccgcaagaatgccgccatctcgcgcggcgtcgggatgacgacg
cagatctatgccgatcgtgccgagaatgcggaaatctgggacaaggacggcaatcgctat
atcgactttgccgccggcatcgcggtcgtgaacaccgggcaccgtcaccccagggtcgtg
caggcggtcaaggaccaactcgaccgctttacccatacctgtcaccaggtcgtgccctac
gagaactacgtcagcctggccgagcggctgaacgccctggtccccggcgatttcgagaag
aagacgatcttcgccaccaccggcgccgaggcggtcgagaacgccgtcaagatcgcccgc
tatgccacgaatcgtagcgcgatcgtcgccttcaccggcgcgttccacgggcgcaccttc
atgggcatgacgctgaccggcaaggtccagccctacaaggcgggcttcggggcgatgatg
cccgatgtctatcacctgccgttcccgaacgatctgcacggcgtcacgcaggacgacgcg
ctggcggcgctggacaagctgttcaaggccgacgtggaccccaagcgcgtcgccgcgatc
atcgtggaacccgtgcagggcgagggcgggttctatcccgtgccctcgggcttcatgcag
aaactgcggtcgctctgcgacgaccacgggatgctgctgatcgccgacgaggtgcagacc
ggctttgcccgcaccggcaagctgttcgcaatggaacaccacggggttgccgccgacatc
accacgatggccaagggcctgggcggcggcctgccgatttccgccgtcacgggccgggcc
gaggtcatggacgcccccaaccccggcggtctgggcggcacctatgcaggcaacccgctg
ggcgttgctgccgcccatgcggtgctggacgtgatcgaggaggagggccttgccgagcgc
gccgaacgccttggccagcggctgaagcagcgccttgcatccctgcgcgacgacgtgccc
gaaatcatcgacatccgcggccccggcctgatgaacgcggtcgagttcaacgtcgccggc
accgagaagcccagccccgatttcaccaacaaggtgcgcgaggaggcgttgtcgcgcggc
ctgatcctgctgacctgcggggtctatggcaatgtcatccgcttcctgccgccgctgacg
gtgccggacgcggtgttcgacgaggcgctggacatcctcgaggcgtcggtgcgggcggcg
cggggggcggggggcaaggccccggcaatcgatggaaacgccggtcccggacagcaggag
gcctga

DBGET integrated database retrieval system