KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_23855Help
Entry
JM49_23855        CDS       T03338                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Brite
Enzymes [BR:pcp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     JM49_23855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5226632..5227276
Genome map
AA seq 214 aa AA seqDB search
MIDLYYWTTPNGHKISLFLEETGLPYSVHPVNIGQGEQFKPEFLKIAPNNRIPAIVDHQP
ADGGAPLSLFESGAILLYLAEKTGQFLPKDLRGRQEALQWLFWQMGGLGPMAGQNHHFSQ
FAPEKIPYAIKRYVDETARLYGVLDRRLADRDFVAGSEYSIADMAIYPWIVSHKWQSQNL
EDFPNLHRWFNRILDRPATARAYAIAARINPPKS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctgtattactggaccacccccaacggccacaagatttccctgttcctcgag
gaaaccggcctgccctacagcgtgcacccggtcaacattggccagggcgagcagttcaag
cccgagttcctgaagatcgcgccgaacaaccggatccccgccatcgtcgatcatcagccg
gccgatggcggcgcgccgctgtcgctgttcgagtccggggcgattctgctgtacctggcg
gaaaagaccgggcagttcctgcccaaggacctgcgtggccgtcaggaagccttgcagtgg
ctgttctggcagatgggcggcctgggaccgatggccgggcagaaccaccatttcagccag
ttcgccccggagaaaatcccttacgcgatcaaacgctacgtcgatgaaaccgcgcgcttg
tacggggtgctggaccgacgcctggcggatcgcgatttcgtcgccggcagcgaatacagc
atcgccgacatggcgatctatccgtggatcgtctcccacaagtggcaaagccagaacctg
gaagacttccccaacctgcaccgctggttcaaccgcatcctcgatcgccccgcgaccgcg
cgcgcctatgccatcgccgcgcggatcaacccacccaaatcctga

DBGET integrated database retrieval system