KEGG   Pseudomonas citronellolis: PcP3B5_20740Help
Entry
PcP3B5_20740      CDS       T04637                                 

Definition
(GenBank) hypothetical protein
Organism
pcq  Pseudomonas citronellolis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 GST_C_6 GST_C_5
Motif
Other DBs
NCBI-ProteinID: AMO75521
UniProt: A0A127MQZ1
LinkDB All DBs
Position
complement(2236516..2237193)
Genome map
AA seq 225 aa AA seqDB search
MSLTLYGAALSPFVRKVRLCLAEKGLDYQLENVDPFNQPDWYADLNPLRRIPALRDGDVT
LADSSVICHYLDDRDPQATPLCGGNALARARISWLEKYADYEVAPLATFTVFRNRLLKPL
LGKPCDEAAVEAALQEKLPPHFDYLEGCLGEAEYFVDDRFSLADIAVASQLVNMRHGGEV
LDAGRWPRLAAHFQRMLQRPALQALLEGEQRVVEKIRARIAQAPA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgaccctctacggcgccgccctatcccccttcgtccgcaaggtccgcctgtgc
ctggcggagaagggcctggactaccagttggagaacgtcgacccgttcaaccagccggac
tggtacgccgacctcaacccgctgcgacgcatccctgccctgcgcgacggcgacgtcacc
ctggccgactccagcgtcatctgccactacctggacgaccgcgatccccaggccacgccc
ctgtgcggcggcaacgccctggcccgcgcgcggatcagctggctggaaaaatacgccgac
tacgaagtggcgcccctggccaccttcaccgtgttccgcaaccgcctgctcaagccgctg
ctgggcaagccgtgcgacgaggcggcggtggaagctgcgctgcaggagaaactgccgccg
cacttcgactacctggaaggctgcctgggcgaagccgagtatttcgtcgacgaccgcttc
agcctggcggacatcgccgtggccagccaactggtgaacatgcgccatggtggggaagta
ttggatgccgggcgctggccgcgtctggccgcgcacttccagcgcatgctgcagcgccct
gccctgcaagcgcttctcgagggtgaacagcgggtcgtcgagaagattcgcgcacgcatc
gcccaggcgccggcctga

DBGET integrated database retrieval system