KEGG   Pseudomonas citronellolis: PcP3B5_21820Help
Entry
PcP3B5_21820      CDS       T04637                                 

Gene name
yfcG_3
Definition
(GenBank) Disulfide-bond oxidoreductase YfcG
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pcq  Pseudomonas citronellolis
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pcq00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PcP3B5_21820 (yfcG_3)
Enzymes [BR:pcq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PcP3B5_21820 (yfcG_3)
Transporters [BR:pcq02000]
 Other Transporters
  Pores ion channels [TC:1]
   PcP3B5_21820 (yfcG_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2356781..2357425
Genome map
AA seq 214 aa AA seqDB search
MSDRRITFYHSPQTRSSGTLALLEELGADYDLHLLNMQAGEQRQPAYLAINPMGKVPAIR
HGEALVTEQGAVYIYLADLYPEAGLAPAIGDPLRGPYLRWLVFYGSSFEPAVTDRSLGRE
PAPQARSPYGDFETVMKVIDEQLQKGPYLLGERFTAADVLWGSALAWTTHFGIVPKTPAI
ERYIAKVTARPSFAKIAERDAQWHAEHAEVAGKV
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccgtcgcatcaccttctaccactccccgcaaacccgttcctccggcaccctg
gcgctgctggaggaactgggcgccgactacgacctgcacctgctcaacatgcaggccggc
gagcagcgccagccggcctacctggcgatcaacccgatgggcaaggtcccggccatccgc
catggcgaggcgctggtgaccgagcagggcgccgtctacatctacctcgcggacctgtac
ccggaagccggactggcgccggccatcggcgacccgctgcgcgggccctacctgcgctgg
ctggtgttctacggctccagcttcgaaccggcggtgaccgaccgctccctcggccgcgag
ccggcgccccaggcgcgcagcccctacggcgatttcgagacggtgatgaaggtcatcgac
gagcagctgcagaaggggccctacctgctcggcgaacgcttcaccgcggcggacgtgctc
tggggctcggcgctggcctggaccacgcacttcggcatagtgccgaagaccccggccatc
gagcgctacatcgcgaaagtcaccgcgcggccctccttcgccaagatcgccgaacgggac
gcgcaatggcacgcggaacacgccgaggtggcgggaaaggtgtag

DBGET integrated database retrieval system