KEGG   Pseudomonas citronellolis: PcP3B5_31160Help
Entry
PcP3B5_31160      CDS       T04637                                 

Gene name
lgrB
Definition
(GenBank) Linear gramicidin synthase subunit B
Organism
pcq  Pseudomonas citronellolis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3435317..3448288
Genome map
AA seq 4323 aa AA seqDB search
MDAFEHPSSMAQALRQRAGTQPDRLALRFLAEDGAGDVVLSYAELDRRARCIAAALQARA
GQGERAVLLFPSGPDYVAAFFGCLYAGMVAVPAYPPESARRHHQERLLSIIDDCAPRLVL
TQAELRGALLEGCPALSGAAAPQLLCVDELDLAGAEAWVETEVRPEHIAFLQYTSGSTAL
PKGVQVSHGNLVANERLIRGGFGIGADDVIVSWLPLYHDMGLIGGLLQPVYSGVPCVLMS
PRYFLERPLRWLEAISQHGGTVSGGPDFAYRLCTERVSESALAGLDLSRWRVAFSGSEPI
RQDSLDAFADKFAASRFEASSFFACYGLAEATLFVSGGQRGQGIAALGVDEAALAQNRIE
AGSDSVLMCCGRSQPEHAVMIVDASDGAALDENRVGEIWAAGPSIAHGYWRNPEASAKTF
VERDGRTWLRTGDLGCLRSGELYVTGRLKDMLIIRGHNLYPQDIERAVETEVDAVRKGRV
AAFAVQVDGEEGIGIAAEVGRALQKRIPADTLIDAIRQAVAEACQEAPKVVALLNPGALP
RTSSGKLQRSACRTRLADGSLDAYAVYPGQAPRAEAAPEQSADALQARIAELWREHLGVE
RVGADDNFFLLGGNSIAAAQAMAALRDSLGVNLNLRLLFEAPRLADFSAAVAARLANGAA
AQAPMAQLPRGGDLPQSAAQRRLWLNWQIEPQGCAYNIPGGLLLRGELDEDAVYDSFARL
VQRHESLRTRFLERDGQALQRIEPRGEFHWQVLQLDAGEAGRRREAEAREPFDLEKGPLL
RVSLVRLDDDLHQLWVTLHHIVADGWSLNLLLDEFARLYAEAQGGQAAELAPLPVGYAEF
ASWQRQWLEAGEGARQLGYWREQLGEEAPVLELPTDHPRGNAASPAARLSLRLDDKLGQA
LREAAQANQASVFMWLLAAFQALLHRHSGQADIRVGVPSANRQRQEVQGLVGFFINTLVL
RATPAPRQAFGQLLAQVREATLGAQEHQDLPFDSLLEALPGHGGQPFQVLFNHQQRDLSA
LRRLPGLLAEELPWHSREAKFDLQLQTEEDARGRLRLNFDYAAELFDAASIQRLADQYVA
LLRQVVAQPQLCLGDIALATDAELARLEQWGSAPCEPARSWLPEQLERELPAHAERVALQ
WDGGELRHAELHAQANRLAHYLRDKGVGPDVPVAICAERSPQLLVGLLAILKAGGAYVPL
DADYPAERLAYMLDDCGASLLLTQSHLLERLPSLEGVATLCFDGLKLDGWPSSAPGLHLH
GDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYALQADDVLMQKAPVSFDVSVWE
CFWPLLAGCRLVLAGPGEHRDPARIAQLVRQFGVTTLHFVPPLLQLFIDEPGVEECTSLR
RLFSGGEALPAQLRDRTLQRLPGVALHNRYGPTETAINVTHWHCSLEDGARSPIGRPLGN
VVCRVLDSELNPLPPGAAGELCIGGAGLARGYLGRPGLSAERFVADPLGVPGARLYRTGD
RARWNEQGVLEYLGRQDRQVKLRGFRIELDEIRARLLAQPGVAQAVVLIRQAGNLGSQVL
GYYTATADAPAEAEHGQALRTALQAALPEYMVPAQLMRLDSMPLGPSGKLDLKALPEPSG
QQREHVAPRDEVEQRLASIWSEVLGLPQVGLDDDFFELGGHSLLATRIVSRARQAFAIEL
PLRELFDASRLGAFAERVRQLRAAGSRDSQGAIRPVDRSQRVPLSYSQQRMWFLWQLEPD
SPAYNVGGMARLRGALDLDCFERALQALVQRHETLRTRFPSVDGVPHQQVQEGSELRMQR
LDFSHLDTEARQQALQQLADDEAHKPFDLEQGPLLRVYMVRLAEDEHYLVVTLHHIVTEG
WAMDIFARELSALYEAFLAGRESPLAPLPVQYLDYSVWQRDWLEAGERQRQLDYWTAQLG
DEHPVLELPGDRPRPPVQSHRGDLYRFDLAPQLAERVRRFNAGNGLTQFMTMTAALAVLL
YRYSGQQDLRIGAPVANRIRPESEGLIGAFLNTQVLRCRLDGQMSVAGLLEQVRQTVIDG
QSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQTRQLAGMTVEYCVNDARATK
FDLNLEVTDLDQRLGCCLTYSRDLFDEPRIARMARHWQNLLAAMIADPQQRLGELPMLDA
GERDALLTCSGPQLSDTLHGLFAAQAAATPQAPALTFAGQSLSYAELDARANRLARLLRE
RGVGPEVRVGLALERSLEMVVGLLAILRAGGAYVPLDPEYPLERLHYMIEDSGVRLLLGE
PALFEALGALPEGVGRCCPAQEGEALAALDDGPLPAFAQPQHLAYLIYTSGSTGKPKGVA
VCHGEIAMHCRAVIERFGMRADDCELHFYSINFDAASERLLTPLLCGAHVVLRAQGQWGA
EDICQLIAEHRVSILGFTPSYGSQLAQWLQTQGRQLPVRLCITGGEALTAEHLQRIRQAF
APRYFFNAYGPTETVVMPLAALAPEQVEAGAGVPIGSLVGERSACLLDADLALVPQGAGG
ELYVGGAGLARGYHERPALTAERFVPDPFGAPGGRLYRTGDRVRQRADGQVEYLGRIDQQ
VKIRGFRIELGEIEARLQEHPQVREAAVLAVDGPSGKQLVGYVGCAEAGADEAAQADLRE
ALKAHLKQQLPDYMVPAHLVLLEGLPLTANGKLDRRALPAPDASLGQRAYEAPRSELERQ
LAAVWGEVLNLAQVGLDDNFFELGGDSILSIQVVSRARQQGIQFSPRDLFQHQSVRSLAG
VARSAGASLAEQGEVQGESALTPIQLWFFELPLENRAHWNQSLLLEPRQALDAELLRQAL
LQLVKHHDALRLTFRQEGGRWHAEHRAADDGAWLLWQAQVASFDDCAEVFERAQRSLALD
GPLLRAVLVDGPGAQRLLLAIHHLVVDGVSWRVLLEDLQQVYRQLAAGEAPQLPAKTSAF
RDWTARLQAYAGSEPLREELHWWRSQLDGAPGAWFCDNPQGRNDEALARSLSLRLDRERT
RQLLQQAPAAYRTQVNDLLLTALARVLCRVSGEASVLVQLEGHGREALFDDIDLSRTVGW
FTSAFPLRLAPAGEPGEAGLAASIKAIKEQLRAVPHKGLGHGVLRHLGDEAGRRALAALP
QPRITFNYLGQFDQSFSEDALFHPLDEPTGAIHDAAAPLPNELSVDGQVYGGELVLRWTY
SAERYEEQTIAELANAYRDELQALIAHCLDDDAGGLTPSDFPLARLSQAQLDALAVPAAQ
IDDVYPLTPMQEGLLLHTLLEPGTGIYYMQDRYRIDSELDRERFAAAWQAVVARHEALRA
SFSWNAGEAMLQVIHKPGRLRIEFLDWSELPADGHEERLQALHKKEREAGFDLLNEPPFH
LRLIRLGAARYWFMMSNHHILIDAWCRGLLMSDFFEIYAALGEGRAPQLPAAPRYRDYIA
WLQRQDLEHSRRWWQQNLNGFERATYIPSDRPILHERAGESGGMIVGDRYTRLDAADGAR
LRELAQRYQLTVNTFAQAAWALVLRRYSGERDLLFGVTVAGRPVGLPQMQRTVGLFINSI
PLRVQLPAPGARQTVRDWLTGLFERNLELREHEHLPLVSIQEASELPKGQPLFDSLFVFE
NAPVEVAVLDRAQSLKASSDSGRTHTNFPLTVVCYPGDDLGLHLSYDQRYFEAPTIERLL
GEFKRLLLALADGFHGDVAELPLLGTEERRFLLEDCNRSEHAYPLEQGYVRLFEARVAAH
PQRIAASCLDQQWSYAELNRRANRLGHALLAAGVGFDQPVALLGERGLDLLGMIVGSFKA
GAGYLPLDPAHPTQRLTRILELSRTPVLVCSAACHEQALALLAELGCGSRPRLLVWDEVQ
HGVAAEHDPQRYSGPRNLAYVIYTSGSTGLPKGVMVEQAGMLNNQLSKVPYLALDEGDVI
AQTASQSFDISVWQFLAAPLFGGRVAIVPNAIAQDPQALLEHVVEQGVSVLESVPSLIQG
MLAEEHKALPGLRWMLPTGEAMPPELARHWLQRYPQVSLVNAYGPAECSDDVAFFRVDAA
STEATYLPIGSPTDNNQLYLLDAEGDFELVPLGAVGELCVAGTGVGRGYVGDPLRTAQAF
VPHPFGAPGERLYRTGDLARRRADGVLEYVGRVDHQVKIRGFRIELGEIEARLHELPEVR
EAAVAVQESATGKYLVGYLVPAATVVEEGAWLEQVRQHLRADLPDYMVPLHWQVLARMPL
NANGKLDRKALPALDIGQALAHAYQAPRTELEGTLAQIWAEVLKVERVGVLDNFFELGGH
SLLATQIASRVQKALQRNVPLRAMFECSTVEELASYIEAQAASAIDERKAARLDDLMSQL
EML
NT seq 12972 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgttcgaacatccctcctcaatggcccaggccctgcgccagcgtgccggcacc
caacccgaccggctggccttgcgcttcctggccgaagacggcgcgggtgacgtggtgctc
agctatgccgagctggaccgccgcgcccgctgcatcgccgccgccctgcaggcccgggcg
gggcagggcgagcgcgcggtgctgctgttccccagcggcccggactacgtcgccgccttc
ttcggctgcctgtacgccggcatggtcgcggtgcccgcctacccgccggagtcggcgcgc
cgccaccaccaggaacgcctgctgtcgatcatcgacgactgcgcgccgcgcctggtgctg
acccaggccgaactgcgcggggcgctgctggaaggctgcccggcgctgtccggcgctgcc
gcgccgcagctgctgtgcgtcgacgaactggacctggccggtgccgaggcctgggtggaa
accgaggtccgtcccgaacacatcgccttcctgcagtacacctccggctccaccgcgctg
cccaagggcgtgcaggtcagccacggcaacctggtggccaacgagcggctgatccgcggc
ggcttcggcatcggcgccgacgacgtgatcgtcagctggctgccgctgtaccacgacatg
ggcctgatcggcggcctgctgcagccggtctacagcggcgtgccctgcgtgctgatgtcg
ccgcgctacttcctcgaacgcccgctgcgctggctggaagccatcagccagcatggcggc
accgtcagcggcgggccggacttcgcctaccgcctgtgcaccgagcgcgtcagcgagtcg
gccctggccggcctggacctgagccgctggcgcgtggccttctccggctccgaaccgatc
cgccaggacagcctggacgccttcgccgacaagttcgccgccagccgcttcgaggcctcc
agcttcttcgcctgctacggcctggccgaggccaccctgttcgtcagcggtgggcagcgc
ggccagggcatcgccgccctgggcgtggacgaggcggccctggcgcagaaccgcatcgaa
gcgggcagcgacagcgtgctcatgtgctgcggccgcagccagccggaacatgcggtgatg
atcgtcgacgccagcgatggcgccgccctggacgagaaccgggtgggcgaaatctgggcc
gccgggccgagcatcgcccacggctactggcgcaaccccgaggccagcgccaagaccttc
gtcgagcgcgacggccgcacctggctgcgcaccggcgacctgggctgcctgcgcagtggt
gagctgtacgtcaccgggcgcctgaaggacatgctcatcatccgcggccacaacctctac
ccgcaggacatcgaacgcgccgtggaaaccgaggtggatgccgtgcgcaagggccgcgtg
gccgcctttgccgtgcaggtcgatggcgaggagggcatcggcatcgccgccgaggtcggc
cgcgcgctgcagaagcgcatccctgccgataccctgatcgacgccatccgccaggcggtg
gccgaggcctgccaggaggcgccgaaggtggtggcgctgctcaaccccggcgcgctgccg
cgcacctccagcggcaagctgcaacgctcggcctgccgcacgcgcctggccgacggcagc
ctggacgcctacgccgtctaccccggccaggcaccccgggccgaagccgcgccggagcaa
agcgccgatgccttgcaggcgcgcatcgccgaactctggcgcgagcacctgggcgtcgag
cgcgtcggcgcggacgacaacttcttcctgctgggcggcaactccatcgccgccgcccag
gccatggccgcgctgcgcgattccctgggcgtcaacctgaacctgcgcctgctgttcgag
gcgccgcgcctggccgacttcagcgccgccgtggccgcccgcctggccaacggcgccgcg
gcgcaagcgcccatggcccagctgccgcgcggcggcgacctgccgcaatccgcggcccag
cgccgcctgtggctgaactggcagatcgaaccccagggctgcgcctacaacatccccggc
ggcctgctgctgcgcggcgagctggacgaagacgcggtctacgacagcttcgcccgcctg
gtgcagcgccacgagtcgctgcgcacgcgcttcctcgaacgcgacggccaggcgctgcaa
cgcatcgagccgcgcggcgaattccactggcaggtgctgcaactggacgccggcgaagcc
ggacggcgccgcgaggccgaggcccgcgagccgttcgacctggaaaagggcccgctgctg
cgggtgagcctggtgcgcctggacgacgacctgcaccagctgtgggtgaccctgcaccac
atcgtggccgacggctggtcgctgaacctgctgctggacgaattcgcccgcctgtacgcc
gaagcgcagggcggccaggccgccgaactggcgccgctgccggtcggctatgccgagttc
gccagctggcagcgccagtggctggaggcgggcgagggcgcccgccagctgggctactgg
cgcgaacagctgggcgaggaagccccggtgctggaactgcccaccgaccatccgcgcggc
aacgccgcctcgccagcggcgcgcctgagcctgcgcctggacgacaagctcggccaggcc
ctgcgcgaagcggcccaggccaaccaggccagcgtcttcatgtggctgctggcggccttc
caggccctgctgcaccgccacagcgggcaggccgacatccgcgtcggcgtgcccagcgcc
aaccgccagcgccaggaagtccaggggctggtgggcttcttcatcaacaccctggtgctg
cgcgccacgcctgctccgcggcaggccttcgggcagttgctggcccaggtgcgcgaagcc
accctgggcgcccaggaacaccaggacctgcccttcgacagcctgctggaagccctgccg
ggccacggcggccagccgttccaggtgctgttcaaccaccagcagcgcgacctttccgcc
ctgcgccggctgcctggcctgctggccgaggaactgccctggcacagccgcgaggccaag
ttcgacctgcaattgcagaccgaggaagacgcccgcggccgcctgcgcctgaacttcgac
tacgccgccgaactgttcgatgccgccagcatccagcgcctggccgaccagtacgtggcg
ctgctgcgccaggtggtggcgcaaccgcaactgtgcctgggcgacatcgccctggcgacg
gacgcggaactggcgcgcctggagcagtggggcagcgcgccctgcgagccggcgcgcagc
tggctgccggaacaactggaacgcgaattgccggcccatgccgaacgcgtggcgctgcaa
tgggacggcggcgaactcaggcacgccgaactgcacgcccaggccaaccgcctggcccac
tacctgcgcgacaagggcgtggggcccgacgtgccggtggccatctgcgccgaacgctcg
ccgcagctgctggtgggcctgctggccatcctcaaggccggcggcgcctacgtgccgctg
gacgcggactaccccgccgagcgcctggcctacatgctcgacgactgcggtgccagcctg
ctgctgacccagtcccacctgctggagcgcctgccgagcctggagggtgtcgccaccctg
tgcttcgacggcctcaagctggacggctggccgagcagcgcgccgggcctgcacctgcac
ggcgacaacctggcctacgtcatctacacctccggctccaccggccagcccaagggcgtg
ggcaacacccacgccgccctggccgagcgcctgcaatggatgcaggccacctacgcgctg
caggccgacgacgtgctgatgcagaaggccccggtgagcttcgacgtctcggtgtgggaa
tgcttctggccgctgctggcgggctgccgcctggtgctggccggccccggcgaacaccgc
gacccggcgcgcatcgcccagctggtgcggcagttcggcgtgaccacgctgcacttcgtg
ccgccgctgctgcaactgttcatcgacgagcccggcgtggaggaatgcaccagcctgcgc
cgcctgttctctggcggcgaggcgctgccggcgcagctgcgcgaccgcacgctgcaacgc
ctgcccggcgtggccctgcacaaccgctacggcccgacggaaaccgcgatcaacgtcacc
cactggcactgttcgctggaggatggcgcgcgctcgcccatcggccggccgctgggcaat
gtggtctgccgcgtcctcgacagcgaactcaacccgctgccgccgggcgccgccggcgag
ctgtgcatcggcggcgccggcctggcccgtggctatctgggccgcccggggctgagcgcc
gaacgcttcgtcgccgacccgctgggcgtgcccggcgcacgcctgtaccgcaccggcgac
cgcgcgcgctggaacgagcagggcgtgctggaatacctcggccgccaggaccgccaggtg
aagctgcgcggcttccgcatcgagctggacgaaatccgcgcgcgcctgctggcccagccc
ggcgtggcccaggccgtggtgctgatccgccaggccggcaatctcggcagccaagtgctg
ggctactacaccgcgaccgccgatgccccggccgaggccgaacacggccaggccctgcgc
accgcgttgcaggcagcattgccggaatacatggtcccggcgcagctcatgcgcctggac
agcatgcccctgggccccagcggcaagctggacctcaaggccctgcccgaaccgagcggg
cagcagcgcgagcacgtcgccccgcgcgacgaagtggagcagcgcctggccagcatctgg
agcgaagtgctgggcctgccgcaagtgggcctggacgacgacttcttcgaactgggcggc
cactcgctgctggccacccggatcgtctcccgggcgcgccaggccttcgccatcgaactg
ccgctgcgcgagctgttcgacgccagccgcctgggcgccttcgccgagcgggtgcgccag
ctgcgcgccgccggcagccgcgacagccagggcgcgatccgcccggtggaccgcagccag
cgcgtgccgctgtcctactcgcagcagcgcatgtggttcctctggcaactggagccggac
agcccggcctacaacgtcggcggcatggcgcggctgcgcggcgcgctggacctggactgc
ttcgagcgcgccctgcaagccctggtgcagcgccacgaaaccctgcgcacccgcttcccc
agcgtcgacggcgtgccgcatcagcaggtgcaggagggcagcgagctgcgcatgcagcgc
ctggacttctcccacctcgacaccgaagcccgccagcaggccctgcagcaactggccgac
gacgaggcgcacaagcccttcgacctcgagcagggcccgctgctgcgggtgtacatggtc
cgcctggccgaggacgagcactacctggtggtgacactgcaccacatcgtcaccgaaggc
tgggccatggacatcttcgcccgcgagctgagcgcgctctacgaggccttcctggccggc
cgcgaatcgcccctggcgccgttgccggtgcagtacctggactacagcgtgtggcagcgc
gactggctggaggccggcgaacgccagcgccagctggactactggaccgcccagctgggc
gacgagcatccggtgctggaactgcccggcgaccgcccgcggccgccagtgcagagccac
cgcggcgacctctaccgcttcgacctggcgccacagctggccgagcgcgtgcgccgcttc
aacgccggcaacggcctgacccagttcatgaccatgaccgccgccctggccgtgctgctg
taccgctacagcggccagcaggacctgcgcatcggcgcgccggtggccaaccgcatccgc
ccggagagcgaagggctgatcggcgccttcctcaacacccaggtgctgcgctgccgcctc
gacgggcagatgagcgtggccgggctgctggagcaggtgcggcagacggtgatcgacggc
cagtcgcaccaggacctgcccttcgaccacctggtggaagccctgcagccgccgcgcagc
gccgcctacaacccgctgttccaggtgatgtgcaacgtccagcgctgggagttccagcag
acccgccagctggccgggatgaccgtggagtactgcgtcaacgacgcccgcgccaccaag
ttcgacctcaacctggaggtcaccgacctcgaccagcgcctgggctgctgcctgacctac
agccgcgacctcttcgacgagccgcgcatcgcccgcatggcgcgccactggcagaacctg
ctggcggcgatgatcgccgacccgcaacagagactgggcgagctgccgatgctggatgcc
ggcgagcgggacgcgctgctgacctgcagcgggccgcaactgagcgacaccctgcacggc
ctgttcgccgcccaggccgcggccacgccgcaggccccggcgctgaccttcgccggccag
agcctgagctacgccgaactggacgcccgcgccaaccgcctggcgcgcctgctgcgcgaa
cgcggcgtgggcccggaagtgcgcgtcggcctggccctggagcgctcgctggaaatggtc
gtcggcctgctggcgatcctcagggccggcggcgcctacgtgccgctggacccggaatac
ccgctggagcgcctgcactacatgatcgaggacagcggcgtgcgcctgctgctcggcgag
ccggcgctgttcgaggccctgggcgcgttgcccgaaggcgtcggccgctgctgcccggcg
caggagggcgaggccctggcggcactggacgacggcccgctgccggccttcgcccagccg
cagcacctggcctacctgatctacacctccggctccaccggcaagcccaagggcgtggcg
gtgtgccacggcgagatcgccatgcactgccgcgcggtgatcgagcgcttcggcatgcgc
gccgacgactgcgagctgcacttctattccatcaacttcgacgccgccagcgaacgcctg
ctgacgccgctgctgtgcggcgcccacgtggtgctgcgggcccagggccaatggggcgcc
gaggacatctgccagctgatcgccgagcaccgcgtgagcatcctcggcttcacccccagc
tacggcagccagctggcccagtggctgcagacccagggccggcagctgccggtacgcctg
tgcatcaccggtggcgaggcgctgaccgccgagcacctgcaacgcatccgccaggccttc
gcgccgcgttacttcttcaacgcctacggccccaccgagacggtggtcatgcccctggcg
gccctggccccggagcaggtggaagccggcgccggcgtgcccatcggcagcctggtgggc
gagcgcagcgcctgcctcctcgacgccgacctggccctggtgccccagggcgccggcggc
gagctgtacgtcggcggcgccggcctggcccgcggctaccacgaacgcccggcgctgacc
gccgaacgcttcgtgcccgaccccttcggcgcgcccggcgggcgcctgtaccgcaccggc
gaccgcgtgcgtcagcgcgccgacggccaggtggaatacctcggacgcatcgaccagcag
gtgaagatccgcggcttccgcatcgagctgggcgagatcgaggcgcgcctgcaggaacac
ccgcaggtgcgcgaggcggccgtgctggccgttgacgggccgagcggcaagcaactggtg
ggctacgtgggctgcgcagaggcgggcgccgacgaggcggcccaggccgacctgcgcgag
gcgctcaaggcgcacctcaagcagcaactgccggactacatggtgccggcgcacctggtg
ctgctggagggcctgccgctgaccgctaacggcaagctcgaccgccgcgcgctgccggcg
ccggacgccagccttggccagcgcgcctacgaggccccgcgcagcgagctggaacgccag
ctggcggcggtctggggcgaggtgctgaacctcgcccaggtcggcctggacgacaacttc
ttcgaactgggcggcgactccatcctctccatccaggtggtcagccgcgcccgccagcag
ggcatccagtttagcccgcgcgatctgttccagcaccagagcgtgcgcagcctggccggc
gtcgcccgcagcgccggcgccagcctcgccgagcagggcgaagtgcagggcgagagcgcg
ctgacgccaatccagctgtggttcttcgaactgcccctggagaaccgcgcgcactggaac
cagtcgctgctgctggagccgcgccaggcgctggacgccgagctgctgcgccaggccctg
ctgcaactggtcaagcaccacgacgccctgcgcctgacgttccgccaggaaggcggccgc
tggcacgccgaacaccgggctgcggacgatggcgcctggctgctctggcaggcgcaggtg
gcgagcttcgacgactgcgccgaagtgttcgagcgcgcccagcgcagcctggccctggac
ggcccgctgctgcgcgcggtgctggtggacggccccggcgcccagcgcctgctgctggcg
atccaccacctggtggtggacggcgtgtcctggcgcgtgctgctggaagacctgcagcag
gtttatcgccaactcgccgccggcgaagcgccgcaactgccggccaagaccagcgccttc
cgcgactggaccgcgcgcctgcaggcctacgccggcagcgagccgctgcgcgaggaactg
cactggtggcgcagccagctggacggcgcccccggcgcctggttctgcgacaacccgcaa
ggccgcaacgacgaggccctggcccgcagcctgagcctgcgcctggaccgcgagcgcacc
cgccagctgctgcaacaggccccggcggcctaccgcacccaggtcaacgacctgctgctg
accgccctggcccgggtactctgccgtgtcagcggcgaggcctcggtgctggtgcaactg
gaaggccacggccgcgaggcgctgttcgacgacatcgacctcagccgcacggtcggctgg
ttcaccagtgccttcccgctgcgcctggcgcccgccggcgagccgggcgaggcggggctg
gcggcttcgatcaaggcgatcaaggaacagctgcgcgccgtgccgcacaagggcctgggc
cacggcgtgctgcgccacctgggcgacgaggccgggcgccgcgccctggccgcgctgccg
cagccgcgcatcaccttcaactacctgggccagttcgaccagagcttcagcgaggacgcc
ctgttccacccgctggacgagcccaccggggccatccacgacgccgccgcgccgctgccc
aacgagctgagcgtggacggccaggtctacggcggcgaactggtgctgcgctggacctac
agcgccgagcgctacgaggagcagaccatcgccgagctggccaacgcctaccgcgacgaa
ctgcaggcgctgatcgcccactgcctggacgacgatgccggcggcctgacgccttccgac
ttccccctggcgcgcctgagccaggcgcagctggacgccctggcggtgccggcggcgcag
atcgacgacgtctacccgctgacgcccatgcaggagggcctgctgctgcacaccctgctg
gagccgggcaccggcatctactacatgcaggaccgctaccgcatcgacagcgagctggac
cgcgagcgcttcgctgccgcctggcaggccgtggtggcgcgccacgaggcgctgcgcgcg
tccttctcgtggaacgccggcgaggccatgctgcaggtgatccacaaacccggccggctg
cgcatcgagttcctcgactggagcgagctgcccgccgacggccacgaggaacgcctgcag
gccctgcacaagaaggagcgcgaggccggtttcgacctgctcaacgagccgcccttccac
ctgcgcctgatccgcctgggcgcggcgcgctactggttcatgatgagcaaccaccacatc
ctcatcgacgcctggtgccgcggcctgctgatgagcgacttcttcgagatctatgccgcc
ctgggcgagggccgcgcgccgcagctgccggccgcgccgcgctaccgcgactacatcgcc
tggctgcagcgccaggacctggagcactcgcgccgctggtggcagcagaacctgaacggc
ttcgaacgcgccacctacatccccagcgaccggccgatcctccacgagcgcgccggggaa
agcggcgggatgatcgtcggcgaccgctacacccgcctggacgccgccgacggcgcgcgc
ctgcgcgaactggcgcagcgctaccagctcaccgtcaacaccttcgcccaggcggcctgg
gccctggtgctgcggcgctacagcggcgagcgcgacctgctgttcggcgtcaccgtggcc
gggcgcccggtgggcctgccgcagatgcagcgcaccgtggggctgttcatcaacagcatc
ccgctgcgcgtgcagttgccggcgccgggcgcgcggcagacggtgcgcgactggctgacc
gggctgttcgaacgcaacctggaactgcgcgagcacgagcacctgccgctggtaagcatc
caggaagccagcgaactgcccaagggccagccgctgttcgacagcctcttcgtgttcgag
aacgccccggtggaagtggcggtgctggaccgcgcgcagagcctgaaggccagctccgat
tccgggcgcacccacaccaacttcccgctcaccgtggtctgctaccccggcgacgacctg
ggcctgcacctgtcctacgaccagcgctacttcgaggcgccgaccatcgagcgcctgctc
ggcgagttcaagcgcctgctgctggccctggccgacggcttccatggcgacgtggccgag
ttgccgctgctgggtactgaggagcggcgcttcctgctggaagactgcaaccgcagcgag
cacgcctacccgctggagcagggctacgtgcgcctgttcgaagcgcgggtggccgcgcac
ccgcagcgcatcgccgccagttgcctggaccagcaatggagctacgccgagctgaaccgc
cgcgccaaccgcctgggccacgcgctgctggccgccggcgtcggcttcgaccagccggtg
gccctgctcggcgagcgcggcctggacctgctgggcatgatcgtcggcagcttcaaggcc
ggcgccggctacctgccgctggacccggcgcacccgacgcagcgcctgacgcgcatcctc
gaactcagccgcacgccggtgctggtgtgcagcgccgcctgccacgaacaggccctggcg
ctgctcgccgaactgggctgcggcagccgcccgcgcctgctggtgtgggacgaggtgcag
cacggcgtagccgccgagcacgatccgcagcgctacagcgggccgcgcaacctggcctac
gtgatctacacctccggctccaccggcctgcccaagggcgtgatggtggagcaggccggc
atgctcaacaaccagctgagcaaggtgccgtatctggcgctcgacgagggcgacgtgatc
gcccagaccgcctcgcagagcttcgacatctcggtctggcagttcctcgccgcgccgctg
ttcggcggccgcgtggccatagtgccgaacgccatcgcccaggacccgcaggccctgctg
gaacacgtggtggagcagggcgtgagcgtgctggaaagcgtgccctcgctgatccagggc
atgctcgccgaggagcacaaggcgctgcccggcctgcgctggatgctgcccaccggcgag
gccatgccgccggaactggcgcggcactggctgcaacgctacccgcaggtgagcctggtc
aacgcctacggcccggcggagtgctcggacgacgtggccttcttccgcgtcgacgcggcc
tccaccgaggccacctacctgcccatcggcagccccaccgacaacaaccaactgtacctg
ctggatgccgaaggcgacttcgaactggtgccgctgggcgcagtgggtgagctgtgcgtg
gccggcaccggcgtcggccgcggctacgtcggcgacccgctgcgcacggcccaggccttc
gtcccgcatcccttcggggcgccgggcgagcgcctgtaccgcaccggcgacctggcgcgg
cgccgcgccgacggcgtgctggagtacgtcgggcgcgtcgaccaccaggtgaagatccgc
ggcttccgcatcgagcttggcgagatcgaggcgcgcctgcacgagctgccggaggtgcgc
gaggccgccgtggctgtgcaggaaagcgccaccggcaagtacctggtcggctacctggtg
cccgccgcgacggtagtagaggagggcgcctggctcgaacaggtgcgccagcacctgcgc
gccgacctgccggactacatggtgccgctgcactggcaggtgctggcgcgcatgccgctc
aacgccaacggcaagctcgaccgcaaggccctgccggcgctggacatcggccaggccctg
gcgcacgcctaccaggcgccgcgcaccgagctggaaggcaccctggcgcagatctgggcc
gaggtgctcaaggtcgagcgcgtcggcgtgctggacaacttcttcgaactgggcgggcac
tcgctgctggccacgcagatcgcctcgcgggtgcagaaggccctgcaacgcaacgtgccg
ctgcgggccatgttcgagtgcagcacggtggaagaactggccagctacatcgaggcccag
gccgccagcgccatcgacgagcgcaaggcggcgcgcctggacgacctgatgtcgcagctg
gaaatgctctag

DBGET integrated database retrieval system