KEGG   Penicillium rubens: Pc13g06620Help
Entry
Pc13g06620        CDS       T01091                                 

Definition
(RefSeq) Pc13g06620
  KO
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
pcs  Penicillium rubens
Brite
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Pc13g06620
Chromosome [BR:pcs03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     Pc13g06620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 1069 aa AA seqDB search
MCRQYFTLYEWCQCEEDAGNSVCAAHRRNGCPGVSVETVHMHCFCNSHATRGFKSEKETR
KKESKLWCWGICGLGFFLERWNSCGFMVFQMIYNKNRVKEDQRDQQSKIDINIRTYICMS
LRDIEETSKRHRVLALCSRVDICKMEYKLPSTQEDPPLGDNGVKNNNIDEAHCEMIDSLN
RLTLAAATPLPSSPRLSPVPSYLPPSKSVHTPPVPAIPLQPNQPAQVVSLQPSQPVQSVS
QTAGSVSVRDERRKSIAPLQKRKSAASLRSVSQPLKSSSPTPDLSRRTSFTSAGSPTTAT
SPAMHPARLVFSPAPEAPVPTASSVAAEHFSKELELHRSGGVNTKTAVIVHDDCYGHRYS
QLEAPKRTLERIVERPERIRACAVGISAAYVRLGSRYAEELAPNPSLSLSEMNVPFQIVK
SDRKVHLSDSTVTDVHGTRWMSELKWMGDRAETRLIMDGNELARQRTKEDDGLGTTGPAL
NNNDLYLCSESVNAFQGALGGVCEGVDLVFKPGPIQRAFVCIRPPGHHCSADHPSGFCWI
NNVHVGISHAATNHGLTHAAILDFDLHHGDGSQDITFDHNSKLLNKAQKADLAKTDATKF
KEYEDAPPYTKAAIGYYSLHDVNSFPCENGEREKVMGASLCLEAHNQSIWNVHLEKWTDL
DGFWKLYQTKYNALLAKARSFLRERTIELNQERQENPNSPMPKAAIFISAGFDASEWEGN
GMQRHSVNVPTEFYAKFTADVIRMSQEEDLGVDGRVISVLEGGYSDRALSSGVLSHLSGL
SENSFKSEWWSQNSLRELDAIMAPTPSKGRKKSTATYLTATKSFAAKAVAPGKDRRSTGD
LQANIAVAPLPEVSWAVATGELSKLIIPNDRQTLSCRPAELNRQRREQSAQDGGLDLIIP
VEKGRQLRSRKPKESAPVPTTPRPATPRRQARKGPKTPKTTTAATTVPAASREASPSVDA
SRRKSTSLTRAGTPHRGVSPLNLPPVPQIPNSVGGVRSGPRIILNMPAREPGRGRKLSGG
AVDHHRRDRSSKSPKKGKKKRGSNSGGSSRASAGSSPLTAAKDATMEDV
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcgccaatactttacactctacgaatggtgccaatgcgaagaagatgccggcaac
agcgtctgcgccgcccaccgccggaacggctgcccgggtgtcagcgtggagaccgtgcac
atgcactgtttctgcaactcgcacgccacgcgtggcttcaagtctgagaaggagacccgc
aagaaggagagcaagctttggtgttgggggatttgcggtctcggtttttttttggaaaga
tggaactcctgcgggtttatggtgttccagatgatatacaataagaacagagtcaaagaa
gatcaaagagatcaacaatcaaagatagacataaatataagaacgtacatatgcatgtcg
ttaagagacatcgaagagacatcgaagagacatcgtgtattggccctttgtagtagagtc
gatatctgcaagatggaatacaagctcccctccactcaggaggacccgccattaggggac
aatggcgtcaagaacaacaatattgatgaggcgcattgtgaaatgatcgattctctgaat
cgcctgactctagcggcggcgactccattgccttcatcacctcgtctttctcctgttcca
tcctatcttcctccctctaaatctgtgcacactccacctgtacctgctattcctctacag
cccaaccaacccgctcaagttgtctctttacaaccaagtcaacctgtgcaatctgtctca
caaacagccggttccgtttctgttcgagacgaacgacgcaagtcaattgcaccactacaa
aagcgcaagtccgctgcatctcttcgttcggtctcgcaaccactcaagtcttcatctcca
acccctgatctatcacgtcgcacgtcgttcacctctgcggggtcgccaaccaccgcaacg
tcacccgcaatgcaccctgcacgccttgtcttcagcccagctccagaagctccagtcccg
actgcttcgtctgtcgcggctgagcacttctcaaaagagcttgaattacatcgatctggt
ggtgtcaacactaaaactgcggttattgttcatgacgactgctacggccatcgctactct
cagcttgaagcgccaaaacgaactctcgagagaattgtcgaaagaccagagcgcatccgc
gcctgcgcagtaggcatatctgcagcctacgtccgcctcggctctcggtatgcggaagag
cttgcgccaaacccaagtttgagcttgagcgagatgaacgttcctttccaaattgtcaag
tctgatcgcaaggtgcatttgtctgatagtactgttacggatgtccatgggacccggtgg
atgtcagaattgaaatggatgggtgaccgtgcagagacacgcctcatcatggatggaaat
gaacttgccaggcaacggacaaaagaagacgacgggcttgggacaactggccccgccctg
aataataacgatctctacttatgctcagagtctgtgaatgccttccaaggagccctgggg
ggcgtctgcgaaggagtggatcttgttttcaagcctggtccgatccagcgagcattcgtc
tgcattcgacctcccggtcaccattgttcagctgaccacccttccggcttttgctggatc
aacaacgtccatgtcggaatctctcacgcagcaacaaaccacggtctgacccacgctgcg
atccttgacttcgatcttcaccatggtgatgggtctcaggacatcacattcgaccacaac
tccaaattactcaacaaagcacagaaggccgacttagccaaaactgatgccacgaaattc
aaggaatatgaagacgctcctccatacaccaaagcagccattggctactacagcttgcat
gatgtgaactctttcccttgtgagaatggcgagcgcgagaaagtcatgggtgccagcctc
tgtctcgaagcacacaaccagtccatctggaacgttcatcttgaaaagtggactgatctg
gatgggttctggaaattataccagacgaaatacaacgcattgctcgccaaagcccgctca
ttcctacgcgaacgtacaatcgaactcaatcaggaacgacaagagaacccgaattccccg
atgcccaaagcggcaatctttatctccgccggatttgatgccagcgagtgggaaggcaac
ggcatgcaacgccacagcgtgaatgttccgactgaattctacgccaagttcaccgcggat
gtcatccgcatgtcgcaagaggaagacctcggtgtagatgggcgtgtcatcagcgtcctc
gagggcggctacagtgaccgcgcattgtcctccggtgtgctcagtcatctgtcaggtctg
agtgaaaactcattcaaaagtgagtggtggtctcagaatagtctgagagaattggatgcc
atcatggctccaacgcccagcaaagggcgcaagaagagtactgccacctacctgacagca
accaagtcctttgcggcaaaggccgtcgccccgggcaaagaccggaggtctaccggggac
ctccaagccaacatcgccgtcgcccctttgccagaagtgagctgggcggtagccacgggg
gagctctcaaagctcatcatccccaatgaccgccagaccctgagctgccgcccggcggag
ctgaaccgccagcggcgagagcagagcgcccaggacgggggtcttgacctcataatcccc
gtcgagaaggggcgccagctgcgctcgcggaagcccaaggagtcggcccccgtgccaacc
accccccgcccagccaccccacgacgccaggcccgaaaggggccgaaaacccccaaaacc
accactgccgccacgaccgtccctgcggcctcccgcgaagcctcaccgtccgtggatgcc
tcccgtcggaagagcaccagtctgacgcgtgcgggaactccgcaccggggtgtcagcccc
ctgaacctccccccagtcccgcagattccaaattccgtggggggagtcaggagcggcccc
cggataattctcaacatgccggcgcgggagcccggtcgtggccgcaagttgtccggcggt
gcggttgaccaccaccgccgtgaccgaagctcaaagtcccccaagaaggggaagaagaag
cgtgggagtaactctggcggaagcagccgagcttccgccggcagttctcccctgaccgcg
gccaaggatgccacgatggaggatgtctaa

DBGET integrated database retrieval system