KEGG   Penicillium rubens: Pc21g15690Help
Entry
Pc21g15690        CDS       T01091                                 

Definition
(RefSeq) Pc21g15690
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
pcs  Penicillium rubens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pc21g15690
Enzymes [BR:pcs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Pc21g15690
Glycosyltransferases [BR:pcs01003]
 Polysaccharide
  Storage polysaccharide
   Pc21g15690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 716 aa AA seqDB search
MEETSEPIKRDVRNHMLFEVATEVANRVGGIYSVLKSKAPVTTAEYGERYTLIGPLNRAS
AAVEVEELSPSNPAMRETIQSMKERGIDIIYGRWLIEGAPRVLLIDTGTGYRWLDEWKGD
LWTTSAIPSPAGDNETNEAIVFGYLVAWFLGEYIAHDRRRAVIAHFHEWLAGVALPLTKK
RHMDLTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERAAAHSCD
VFTTVSHITAFESEHLLKRKPDGVLPNGLNVKKFSAMHEFQNLHSQAKEKINDFVRGHFY
GHNDFDLDNTLYLFTAGRYEYRNKGVDMFIEGLARLNHRLKSAGSTMTVVAFIIMPAQTS
SLTVESLKGQAVVKSLRDTIENIEKGIGKRMYERCLSWKEGDNMPDEKDLITSQDRVMLR
RRLFGMKRHGLPPIVTHNMHNDHEDPILNQLRRVQLFNHSSDRVKVIFHPEFLNSANPVL
PLDYDDFVRGTHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYG
IYIVDRRAKGVDDSVNQLADFMFHFTEKSRRQRINQRNRTERLSDLLDWKRMGLEYVKAR
QLALRRAYPSSFEGQEDYFDIIGGTEQKLSRPLSVPGSPRDRSGMMTPGDFASLQEGHEG
LSTEDYIAWKLPEEEEPEEHFPLTLRTRKMTERAASPLDSISINGREESEVGARTA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaaccagtgaacctatcaagcgtgatgtgcgcaaccatatgctcttcgaggtg
gccactgaagtggccaaccgagtaggtgggatctattcggtcctcaagtccaaagctccc
gtgaccaccgccgaatatggtgaacggtacactctgatcggtccacttaatagggcttca
gctgcagtggaggttgaggagctatcaccgtccaacccagccatgcgggagacaatccag
tctatgaaggagcgcgggattgacattatctacggtcgctggctcattgagggtgcccct
cgagttctgctcattgacacagggactggctatcggtggttggacgagtggaagggcgat
ctttggactacttcagccatcccatcccccgctggtgataatgagaccaacgaggccatc
gtttttggatacttggttgcttggttcttgggagagtacattgctcacgaccgtcgccgc
gcggtcatcgcccatttccatgaatggctggctggtgtcgctctgccattgaccaagaag
cggcacatggacctcacaaccgtcttcaccacccacgcgacattattgggtcgttacctc
tgtgctggctcggttgacttctataacaacctccagtactttgacgtggatgcggaggcc
gggaagcgaggaatctaccaccgctactgtattgagcgggcagctgctcattcctgtgat
gtctttaccactgtatcgcacatcactgcatttgagagcgaacacctgctaaagcgcaag
cccgatggggtgctgccaaacggtctgaatgtcaagaagttctctgccatgcacgagttc
cagaacttgcactcccaggccaaggagaagatcaatgatttcgttcgtggccatttctac
ggccacaacgactttgacctggataatactctatatcttttcactgcgggtcgttatgag
taccgcaataagggtgtcgatatgttcattgaggggctggcccgcctcaatcatcgactg
aagtctgctgggtcgaccatgaccgtggtcgctttcataattatgccagcccaaacctct
tcgttgacggtggaatcgctcaagggacaggccgttgtcaagtctctgcgcgataccatc
gagaatatcgagaagggaatcggcaagcgcatgtatgagcgctgtctttcctggaaggaa
ggtgacaacatgcctgatgagaaagatctcatcaccagtcaagatcgtgtgatgcttcgc
cgtcgcctgttcggcatgaagcgccacggtcttcctccaattgtcacccacaacatgcac
aatgaccacgaggaccccatcctgaaccagttgcgtcgggtgcagctgttcaaccactcc
tctgaccgggtgaaggtcatctttcacccggaattcctcaactccgccaaccctgtattg
ccgcttgactacgacgacttcgttcgtggaacccatctaggcgtcttcccctcctactat
gagccatggggatatacaccagccgagtgtacagtgatgggtgtgcctagcatcaccacc
aacctgtctggattcggttgctatatggaggagttgattgaaaactcctcggattatgga
atatacattgtggaccgccgcgccaagggcgttgacgactcggtcaaccaactggccgac
tttatgttccacttcacagagaagagtcgtcgccagcgcattaaccaacgtaaccgtacg
gagcgcctgagcgatttgcttgactggaaaaggatgggcttggaatatgtcaaggctcgg
cagctggcattgagaagagcttacccatcctccttcgagggtcaagaggactacttcgat
atcattggaggaacggagcagaagctctcccgcccgctttccgttcctggatctcctcgg
gatcgctccggaatgatgacacccggtgactttgcctctctgcaggaaggccacgaggga
ttgagcaccgaggattatattgcctggaaactgcctgaagaggaagaacccgaggagcac
ttccccctcacactgcgaacccgcaagatgactgaacgggctgcatccccactggacagt
atatcgatcaatggccgtgaagagtccgaagtaggagctcggactgcatag

DBGET integrated database retrieval system