KEGG   Candidatus Protochlamydia amoebophila: pc1759Help
Entry
pc1759            CDS       T00172                                 

Gene name
sodC
Definition
(GenBank) putative Superoxide dismutase (Cu-Zn)
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pcu  Candidatus Protochlamydia amoebophila
Brite
Enzymes [BR:pcu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     pc1759 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CAF24483
UniProt: Q6MAB6
LinkDB All DBs
Position
complement(2102482..2103099)
Genome map
AA seq 205 aa AA seqDB search
MSKQSFHHALRFSKFFAAALLVITAASCACKDSHAHTRQNNNKNNEVADAGVIQIRQIKK
AKAVVHGVNDNKVRGTVTFTKVIGGVKIIADVMGLTPGKHGFHIHEFGDCGKNGEAAGAH
FNPMNQKHGGPDSLERHVGDFGNLEADSHGHAHYERVDKFIELDGKNSIIGRSIMIHADE
DDFKTQPSGASGARIGCGTIEIENE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaatcatttcatcatgctttacgattttcaaagttttttgcagcagcttta
cttgtcataacagccgcaagttgcgcatgtaaagattctcatgctcatacacgacaaaat
aacaataagaataacgaagtggcagatgctggtgtaattcagattcgtcaaattaaaaaa
gctaaagctgttgtacatggagttaatgataacaaagtcagaggaacagtgacatttaca
aaagttattggaggagtcaaaattattgcagatgtaatgggattaacgccaggtaaacat
ggttttcacatccatgaatttggcgattgtggaaaaaatggtgaagcagctggtgctcat
tttaatcccatgaatcaaaaacatggcggtcctgatagtttggaaaggcatgtgggagat
tttggtaatttagaagctgatagccatggacatgctcattatgaaagagtagataagttt
atcgaactagatggtaaaaattcaattattggtcgctcgattatgattcatgctgatgaa
gatgattttaaaactcaaccaagtggtgcttctggagctagaattggttgcggaacaatt
gaaatcgaaaatgaataa

DBGET integrated database retrieval system