KEGG   Plasmodium cynomolgi: PCYB_084280Help
Entry
PCYB_084280       CDS       T02490                                 

Definition
(RefSeq) FAD-dependent glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pcy  Plasmodium cynomolgi
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PCYB_084280
Enzymes [BR:pcy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PCYB_084280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
8
AA seq 638 aa AA seqDB search
MLRKAIAASGGLGMMGAGCVYLLKVNFHKNMIDGDVEYKYSSVSSRSEMINRLKKNQYDV
LIIGGGATGAGLALDCATRGIKCALIDKGDFSSGTSSKSTKLLHGGIRYLENAVKNFDLT
ELYFVWEALGERAHAMKIAPFMSRSVPIIMPIYKYWQVPYFAYNIKVYDLLADLVCYFDK
GVPNSSYIRHSNTVDGFPLLKKEQLKGSLVYYDGQHNDSRMNLNLILTSAMENYIPGQVG
ATVCNHMEVVGFIKDDDGKKIVGVRAVDRISNKEIEIFAKVIVNATGPHGDVVRKLADET
VTPVIQTSSGCHFILPKWYSSKNNGMIIPKTSDGRVLFLLPWENATIVGTTDEQRQLEEN
PQIQKKDTDFLASELSKYINVDADEIKNDIKAAWCGFRPLVMDTKAKKKASTKKTTSKSQ
AKGDNQTTNTEAITTHKISRSHEIIEDDNGLISILGGKWTIYRKMAQDTVDYISKKHCDK
VKTKYNCRTKFLMLVGSHDEQGKHNMDDLTYGSSKLSKKLVQKYSKIDYDTAHHLVSNYG
YLAEKVCELATELNLFNKIDASKPYIEAEVVYASRYEFASTISDIIGRRFRLGFVDSAVS
GKVISKIASLMKDELSWSRDQMNRNIEDAKLYVRSLSL
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggaaggctatcgccgcgtccggcggcctcggaatgatgggagcggggtgtgtg
tacctgctgaaggtgaactttcacaaaaatatgattgatggagatgtggagtacaagtac
agctctgtgagcagtcgtagcgaaatgataaaccgcctgaagaagaaccaatacgatgtg
ttaataataggaggaggcgccactggcgcgggattagccctagactgcgccacgagggga
atcaagtgtgccctaatagacaagggggacttctcaagtggtacgtcctctaagtcaacc
aaattattacatggaggaatacggtatctagaaaatgcagtaaaaaattttgatctcaca
gagttatattttgtatgggaagcattaggagaaagagctcatgctatgaagatcgcccca
ttcatgtctaggtcagtaccaattataatgcctatttacaaatactggcaggttccctac
ttcgcatataacataaaggtatacgatcttttggcggacttagtgtgctacttcgacaag
ggggttcctaactcaagttacatcaggcattccaacacagttgatggtttccccctgctg
aagaaggaacaactgaaaggatcactagtgtattacgatgggcagcataatgatagccgt
atgaatctgaacctgattctgacgagcgctatggagaattatatccccggacaagtggga
gccactgtgtgtaatcatatggaagtggtaggcttcataaaggatgatgatggaaagaaa
atcgttggagtgagagcagtagaccgaattagcaataaagaaatcgaaatatttgctaag
gttatcgtgaatgctacaggaccacatggagatgtggtgagaaaactggcagatgaaact
gtcaccccagttatacagacctcctcaggatgccatttcatcctccctaaatggtattcc
tccaaaaataatggaatgatcatacctaagacaagtgacgggagagtcctttttttgtta
ccttgggaaaatgctaccatagttggaactactgatgagcagagacaactagaagagaac
ccacagattcaaaaaaaagacacggactttttagctagcgaattatctaaatacataaac
gtagatgcagatgaaattaaaaatgatataaaagctgcttggtgtggattcagaccacta
gttatggataccaaggcaaaaaaaaaagcttccactaagaagaccacttcgaaaagtcaa
gctaaaggagacaaccaaactaccaacacagaagctataacaacacacaaaatttcgaga
agtcatgaaattattgaagatgacaatgggcttatcagcattttaggaggaaaatggact
atatataggaagatggctcaggatactgtagactacatatcgaagaaacactgcgataag
gttaaaactaagtataactgcaggacgaagtttttgatgcttgttggtagtcatgacgaa
cagggaaaacacaacatggatgatttaacttatggtagtagtaagctgagcaaaaaactg
gttcaaaaatatagcaaaattgattacgacactgctcatcacctcgtgtccaactatgga
tacttggcagagaaggtatgcgaactagctacggagctgaatctattcaacaaaattgat
gcgtcgaaaccgtatatcgaagcggaagtggtctatgccagtagatacgaattcgcttcc
accatttcggatatcattgggagaaggttccgactagggttcgtcgactccgctgtgtcc
ggtaaggtcatctccaaaattgccagcctcatgaaggacgagttgagttggagccgcgac
caaatgaacaggaatatcgaggacgccaagctctacgtccgatcgctctccctg

DBGET integrated database retrieval system