KEGG   Phoenix dactylifera (date palm): 103702046Help
Entry
103702046         CDS       T03274                                 

Definition
(RefSeq) histone deacetylase 2
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
pda  Phoenix dactylifera (date palm)
Brite
Enzymes [BR:pda01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103702046
Chromosome [BR:pda03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     103702046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 356 aa AA seqDB search
METASSSSAVPELAGASATLRRNRILSSKLYVDVPLSKVPLIYSTSYDIAFLGIEKLHPF
DSSKWGRICKFLIKEGVLDWSRIVEPLEASKDDLLVVHSEAYLSSLKSSLTVSIIIEVPP
VAILPNCLVQHKVLYPFRKQVGGSILAAKLAIERGWAINVGGGFHHCSAEKGGGFCAYAD
ISLCIHFAFVRLNISRVMIIDLDAHQGNGHEIDFSDDRRVYILDIYNSGIYPFDLEARRY
IDQKVELLSGTKTNEYLEQLDKALEVAGNNFNPELVVYNAGTDILDGDPLGRLKVSPEGV
SIRDEKVFRFARERNVPLLMLTSGGYMKSSAQVIADSIINLSEKKLIDLDSPLRRK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgcgtcttcctccagcgccgtcccggaactcgccggcgcctccgccactctc
cgccgcaatcggatcctctccagcaagctatacgtcgatgtgcccctctccaaggttccg
ttgatctactcgacttcctacgacatagcatttcttggaatcgagaagctgcatcctttt
gattcttcaaaatggggtcgtatttgcaagttcctgattaaagaaggtgttttagactgg
tctcgaattgtagaaccattagaagcttcaaaggatgatttgctggtggttcactcagaa
gcatacctgagcagtcttaaaagcagtttaacagtttccattattattgaggtaccccct
gttgcaatccttccaaactgtcttgtgcagcataaagtgctttatccattccgcaaacag
gttgggggttcaatcttggcagctaaacttgcaatagagcgaggatgggccattaatgtt
ggtgggggattccaccattgttcggcagagaaaggaggtggattttgtgcatatgctgac
atttctctttgtattcactttgcctttgttcgtttgaatatttcgagggtaatgattatt
gatcttgatgctcaccaaggaaatggccatgaaatagacttctctgatgacagaagagtt
tatattttggacatctacaactctggaatatatccttttgatcttgaggctaggaggtac
atcgaccagaaagttgaattactaagtgggactaaaacaaatgagtatttggagcaattg
gataaagcacttgaggttgctggaaataacttcaatcctgagttggttgtgtacaatgct
ggcactgatattctcgatggagatcccttgggcagattgaaggtcagtcctgagggagtt
tcaatcagagatgaaaaggtattcagatttgccagggaaagaaacgtacctcttctaatg
cttacatcaggtggctatatgaagtcgagtgctcaagttatagcagattcaattatcaac
ctttcagaaaaaaaactgatagatttggatagccctcttaggagaaaataa

DBGET integrated database retrieval system