KEGG   Phoenix dactylifera (date palm): 103722583Help
Entry
103722583         CDS       T03274                                 

Definition
(RefSeq) alpha-amylase isozyme 3D-like
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103722583
Enzymes [BR:pda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     103722583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 426 aa AA seqDB search
MGRPLDPLFLALVLVLSLAPNWAAAQILFQGFNWESWKKEGGWYNFLKGQVSDIANAGVT
HVWLPPPSHSVSEQGYLPGRLYDLNVSKYGNRGELKSLISEFHEKGIKCIADIVINHRCA
DKKDGRGVYCIFEGGTPDDRLDWGPTMICSDDTKYSDGTGHPDTGLGFDAAPDIDHLNPR
VQRELSDWMNWLKSDIGFDGWRLDFARGYSSDIAKIYVDQTTPSFVVAEIWSSLAYGNDG
KPAYDQNAHRQELVNWVQTVGSPATAFDFTTKGILQAAVQGELWRMRDSKGEASGMIGWW
PEKTVTFVDNHDTGSTQRQWPFPSDKVMQGYVYILTHPGIPSIFYDHLFDWGLKKPIGEL
AAIRSRNGIHPGSSLRIMVSDSDLYVAAIDEKIIAKIGPRYDVGNIVPSNYHIVASGNDY
CVWEKK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggcctttggatccattgttcttagcactggtgctggtgctgtctcttgcaccc
aactgggctgctgctcaaatcctctttcagggttttaactgggagtcatggaagaaagaa
gggggatggtataactttctgaagggccaagtgtctgacattgccaatgctggggttacg
catgtctggctccctccaccctcgcattcggtatccgaacaaggttatttgccaggaagg
ttgtatgatctgaatgtatcgaaatatgggaaccgaggcgagctgaagtcactgatcagt
gaattccatgaaaaaggaatcaaatgcattgctgacattgtcatcaatcacagatgcgca
gataaaaaagatgggagaggcgtatactgtatctttgaaggcgggacgcctgatgaccgc
ctcgactggggcccgaccatgatctgcagtgacgacaccaaatactccgatggcaccggc
caccctgacactggccttggcttcgatgcggctccggacatcgaccacctcaacccaagg
gtccaacgtgagctctcggattggatgaattggctcaagagtgacatcggtttcgatgga
tggcgacttgattttgccagaggatactcatcagacattgccaagatttatgtagatcaa
accacaccgagttttgtggttgcagagatttggagctctttagcttatggaaacgatggc
aagccagcttatgaccaaaatgctcaccgccaagagctagttaattgggttcaaacagta
ggcagtccagcgacagcttttgatttcaccaccaagggaatactgcaagcagcagtgcag
ggggagctgtggaggatgcgtgattccaagggagaggcatctgggatgattggatggtgg
ccagagaagacggtcacattcgtcgacaaccatgatactggttcaacgcagaggcaatgg
ccttttccttctgataaggtcatgcaaggctatgtttacattctcacacacccagggatt
cccagcatcttctatgatcacttgtttgattggggtttgaagaagccgatcggtgagttg
gcagcaatcaggtccaggaatgggattcatccaggtagctcattgcgcatcatggtttcc
gacagtgatctctatgtggcggcaattgatgagaagattattgcaaagattggaccaaga
tatgatgtcgggaacattgttccttcgaactaccacattgttgcctctggtaatgactac
tgtgtatgggagaagaagtga

DBGET integrated database retrieval system