KEGG   Planococcus donghaensis: BCM40_06710Help
Entry
BCM40_06710       CDS       T04451                                 

Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
pdg  Planococcus donghaensis
Brite
Enzymes [BR:pdg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     BCM40_06710
Peptidases [BR:pdg01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BCM40_06710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: ANU23075
UniProt: A0A1C7EH81
LinkDB All DBs
Position
1885436..1887097
Genome map
AA seq 553 aa AA seqDB search
MNKKKLLTLSLAASLALSATAVSANTAPTQETTEKVHINKETKMPDMIYGKLTTPSNKSA
KEIVFTYLEENEELYKFGKKELSNFKIVSQEKDDLGFTKLKMQQMFKGVPVFGSVINAHV
DQDGVLNSVSGNLTPELYNKQSLKKGATLKADVALEKAKADLNKKIGSTPELESEVTPEL
VVYFQDGNANYAYSAEFEFLYPEPGNYQYFVDAKTGEILDSYNQIHEAKPSTGGQGITGS
DSTGTGKGVLGDTKTFNTLTNSSGSYLVDRTRGNGIFTYDAKNRTRTPGTLWLDSDNVYN
AAYDGAAVDAHAYAGQTYDYFKDVHNRNSYDGNGADLVSTVHYGRDYNNAFWSGSQMVYG
DGDGNTFVPLSGALDVIAHELTHAVTDTTADLIYQNESGAINESMSDIFGTLVEFHFNNN
PDWQVGEDIYTPNIAGDALRSMQDPTLSGDPDHYSKRYTGTGDYGGVHINSGISNKAAYL
LANGGTHYGVSVNGIGNDKAGAIYYRTLTQYLTPNSNYSHFRVSTIQAATDLYGASSAEV
ASVKAAFTAVGVN
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaaaaaattactgactttaagtttggcagcatcactagcgttatcagcaaca
gcggtttctgcaaataccgccccaacacaagaaacaacagaaaaggttcatatcaataaa
gaaaccaaaatgcctgacatgatatatgggaaactaacgactccatccaataaatcagct
aaggaaattgtgtttacatacttagaagaaaatgaggaactttacaaatttggcaaaaag
gaactttctaactttaaaattgttagccaggaaaaagatgatcttggctttacaaaactg
aaaatgcaacaaatgtttaaaggcgttcctgttttcggttcagtaatcaatgcgcatgtg
gatcaagacggcgtattgaactccgtttcaggtaatttaacgccagaattatacaataag
caatccttgaaaaaaggcgctacgttaaaagcagacgtagcacttgaaaaagcaaaagct
gacttgaataaaaaaattggcagtactccagagttagaatctgaagtaacacctgagctg
gtcgtttacttccaagatggaaatgcgaactatgcctacagtgcagaatttgaattcctc
tatccggaacctggcaattatcaatactttgtcgatgctaaaacaggtgaaatcttagat
tcatataaccaaatccacgaagcaaaaccttcaacaggtggacaagggataacaggaagc
gactccactggtacaggtaaaggtgtattaggagatacaaaaaccttcaataccttaacc
aacagcagtggttcatatttagtagatagaactcgcggaaatgggattttcacatacgat
gctaaaaatcgcacacggacaccaggaactttatggcttgatagcgacaacgtttataac
gctgcatatgacggtgctgcagtcgatgctcatgcatatgccggtcaaacctatgattat
ttcaaagatgttcataaccgcaatagctatgatggcaatggggctgatttagtatccact
gtccattacggccgtgattataacaatgctttctggagtggctctcaaatggtttatgga
gatggggacggcaatacgtttgtgcccctatcaggtgctttagatgtaattgctcatgaa
ttgacacatgctgtgacagatactacggcggacttaatttatcaaaacgaatcaggcgcg
attaacgaatccatgtctgatatttttggaacactcgttgaattccatttcaacaacaac
cctgattggcaagttggagaagatatttacacaccaaatattgcaggtgatgcacttcgt
tcaatgcaagatcctacgttaagcggagatcctgaccattattcaaaacgctacacaggt
actggtgattacggcggcgttcatatcaattctggaattagcaacaaagctgcatatttg
ttagctaacggaggtacgcattacggagtaagtgtcaatggaattggcaatgataaagca
ggcgctatttattaccgtacattaactcaatatttaacgccaaattcaaactacagtcat
ttccgcgtttcgacgatccaagcggcaactgacctatacggagcttcaagcgcagaagtt
gcaagtgtgaaagctgcgtttacagctgtaggagttaattga

DBGET integrated database retrieval system