KEGG   Paenibacillus donghaensis: B9T62_35295Help
Entry
B9T62_35295       CDS       T04971                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pdh  Paenibacillus donghaensis
Brite
Enzymes [BR:pdh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B9T62_35295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2935
Motif
Other DBs
NCBI-ProteinID: ASA25540
LinkDB All DBs
Position
complement(7747412..7748599)
Genome map
AA seq 395 aa AA seqDB search
MLYVYGPMMPARILEEIVFWKNQEKEHTVVIKALIPQLEEPYVKLLNEWAAVFAATSQAA
AQLLESAVAPVPPGSSHLIPETEQLIYIACTQSHEFIRQLYAMMESSPAVNAQPLSSVVL
LHFIRESQYFLAMLESLSQAGQLSRAMRSDSELPQPAGDQPTAQKSSLQPASVSTAAAPS
SSVREPGSVPIGGHTLPPLPYAYNALEPYIDEKTMRIHHDIHHKSYVDGLNKAELKLADA
RTSGDFDLVKHWERELAFHGAGHYLHTLFWTIMSPQGGGRPTGALLAEIGRSFGSFDAFK
RQFSEAAEKVEGGGWAILVWSPRSRRLEILTAEKHQNLSQWDVIPLLALDVWEHAYYLKH
QNKRGDYIKDWWKVVNWRQVSERYAAASKLAWQPY
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgctatatgtatacggtccaatgatgcctgcgcgcattctggaggaaattgtattctgg
aagaaccaggagaaagagcataccgtggtcatcaaggcgctgatcccgcagttggaggag
ccttatgtgaagctgctgaatgagtgggccgcagtgtttgccgccacctcgcaggcagcg
gcgcagctgctggaatcggcggttgccccggtcccccccggttcctctcaccttattcct
gaaacggagcagctgatctacatcgcctgtacccagtcccatgaattcatccgccagctg
tacgccatgatggagagcagtccggcagtaaacgcccagcctctatccagtgtggtactg
ctgcatttcatccgcgaaagccagtatttcctcgcgatgctggaatcccttagccaggca
ggccagctgtcccgcgctatgagaagcgacagcgagctgccgcagcctgccggtgaccaa
ccgacagcccagaaaagctcactgcagcctgcttccgtatcaacggcagcggccccttcc
tccagtgtgcgtgagcccggttcggtacccataggcggacatacccttcccccactgcct
tatgcctataatgcgctggagccatatatcgacgagaagacgatgcgtatccaccatgac
atccaccacaagagttatgtagatggcctcaacaaggctgagctgaagcttgcagacgcc
cgaacaagcggcgacttcgacctcgttaagcattgggaacgtgagctggccttccacgga
gccgggcattacctgcacacgctcttctggacaatcatgtccccacagggcggcgggcgg
cccacaggagcgctgctggcagagattgggcgcagcttcggcagcttcgacgccttcaaa
cgccagttcagcgaagcggcggagaaggtggaaggcggcggctgggccatcctggtctgg
agcccacgcagccgcagactcgagattctgactgcggagaaacatcagaacctgtcccag
tgggatgtaatcccgctgcttgccctggatgtatgggagcatgcctattacctcaagcac
cagaacaaacgcggcgattacatcaaggattggtggaaggtggtcaactggcggcaggtg
tccgaacgatatgctgccgcgagcaagctggcctggcagccctactaa

DBGET integrated database retrieval system