KEGG   Penicillium digitatum: PDIP_45490Help
Entry
PDIP_45490        CDS       T04849                                 

Definition
(RefSeq) MAP kinase MpkB
Organism
pdp  Penicillium digitatum
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 26232867
NCBI-ProteinID: XP_014534839
UniProt: K9GH69
LinkDB All DBs
Position
Unknown
AA seq 354 aa AA seqDB search
MVQPSPPAGGSRKISFNVSDQYEIQDVIGEGAYGVVCSAIHKPSGQKVAIKKITPFDHSM
FCLRTLREMKLLRYFNHENIISILDIQRPRNYEGFNEVYLIQELMETDMHRVIRTQDLSD
DHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASTDDNSGF
MTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDV
LGTPTMEDYYGIKSRRAREYIRSLPFKKKIPFRALFPKSNDTALDLLEKLLAFNPAKRIT
VEEALKHPYLEPYHDPEDEPTAPPIPEGFFDFDKNKDALSKEQLKLLIYEEIMR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggttcagccaagccctcccgcgggaggatcccgaaagatctccttcaatgtttccgac
caatatgaaattcaagatgttatcggtgaaggcgcctatggtgtcgtctgctctgccatt
cacaaaccctcggggcagaaggttgccatcaagaagatcacccccttcgatcattccatg
ttctgcctgcgtacactgcgtgagatgaagttgctgcgatactttaaccacgagaacatc
atctccatcttggatattcagcggccccgtaactacgagggattcaatgaagtttatctg
attcaagagttgatggaaacagacatgcatcgggttatccgcacacaagacctctcagac
gaccactgccaatacttcatctatcagaccctgcgtgcactcaaggcaatgcactcagcc
aacgtgctccaccgagacttgaagccctcaaatcttcttctcaatgccaactgtgacctg
aaagtctgcgacttcggtctggctcgttcggccgcctccaccgacgacaattccggattc
atgacagaatatgtggccacacgttggtaccgtgcaccagagatcatgttgacattcaag
gaatacaccaaggctattgatgtgtggagtgtcggctgcatattggctgagatgttgagc
ggaaagcctctcttccctggcaaggattatcaccaccagctgaccctcatcctggatgtc
ctcggcacacccacgatggaagattactatggcatcaaatcccgccgtgcccgcgaatac
atccgctcccttccctttaagaagaagattcctttccgcgcactcttccccaagagcaat
gatacggctctggatctcctcgagaagctgcttgctttcaatccggctaagcgtatcact
gtcgaggaagccttgaaacacccttacctcgagccataccatgatcccgaagatgagcct
actgcaccgcccattcccgagggattcttcgatttcgacaagaacaaggatgcgctgagt
aaggagcagttgaagctcttgatctacgaggaaattatgcggtaa

DBGET integrated database retrieval system