KEGG   Penicillium digitatum: PDIP_72250Help
Entry
PDIP_72250        CDS       T04849                                 

Definition
(RefSeq) Histone deacetylase RpdA/Rpd3
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pdp  Penicillium digitatum
Brite
Enzymes [BR:pdp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PDIP_72250
Chromosome [BR:pdp03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PDIP_72250
   HDAC complexes
    Sin3A-HDAC complex
     PDIP_72250
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    PDIP_72250
  Chromatin remodeling factors
   NuRD complex
    PDIP_72250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 625 aa AA seqDB search
MALEPISDRLLGSKNKKVAYFYDSDVGNYAYVSGHPMKPHRIRMTHSLVMNYGLYKKMEI
YRAKPASKYEMTQFHTDEYIDFLSKVTPDNMDHFSKEQSRYNVGDDCPVFDGLFEFCGIS
AGGSMEGAARLNRNKCDIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLRFKQRVLYV
DIDVHHGDGVEEAFYTTDRVMTCSFHKYGEYFPGTGELRDIGVGQGKNYAVNFPLRDGIT
DVTYKSIFEPVIKSVMEWYRPEAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNFVKSFDL
PTLVLGGGGYTMRNVARTWAYETGILVGEPLGSELPYNDYYEYFAPDYQLDVRPSNMDNA
NTREYLDKIRNQVVENLKRTAFAPSVQMTDVPRNPILDGMDDEADDVMDDLDEDENKDKR
FTQRRFDQRTEKAGELSDSEDEAENAANGVRRQPGATRRRNQVNYRNLEPDSGLDSGMAT
PQDGSSAADGEMDFAIDSKMTDAPRTEPEAPDADHTAIESEEQEASTASQHQSPPTHDED
ITMEDAAVAEPIALEQASTQASIAEDKHPVEGSTASPVRAHSPPKEAAGHTIEKIVKASA
LTADNEATATKEENLEHMSEPKKEE
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggctttggaacctatctctgatagacttcttgggtctaaaaataagaaagtcgcatac
ttctacgactccgatgtgggcaactatgcctatgtctcgggccacccgatgaagcctcat
cgcatacgcatgacacacagcttggtgatgaactatggcctctataagaaaatggagatc
taccgtgcgaaacctgcctcaaagtacgagatgacccagttccacaccgacgaatatatc
gacttcctgtccaaggtcacacccgacaacatggatcacttctcaaaggagcagagccgg
tacaacgttggagacgattgccccgtgtttgacggtctcttcgagttctgcggaatcagc
gctggtggcagcatggaaggcgctgcgcgactgaaccgcaacaaatgcgatattgccgtc
aactgggctggtggtcttcaccacgccaagaagagcgaagcaagtggcttctgctatgtc
aatgatatcgttcttggaattctggagcttctgcgcttcaaacaacgagtcctttacgtt
gatattgatgttcaccacggcgatggtgtcgaagaggctttctacactactgatcgcgtc
atgacctgttctttccacaaatacggcgagtacttccctggtaccggtgagcttcgcgac
atcggtgttgggcaaggcaaaaactacgcagtgaactttcctctccgggatggcatcact
gatgtcacatacaaaagcatcttcgagcccgttattaagagcgtgatggagtggtaccgc
cccgaggccgtggtccttcagtgcggtggagacagtttgtccggtgatcgcttgggctgc
ttcaacctgagcatgcgaggacatgccaactgtgttaacttcgttaagagctttgatctg
ccaaccttggttcttggcggtggtggctacaccatgcgcaacgttgcacggacatgggct
tatgagaccggtatccttgttggagagcccctgggatcagagctgccatacaatgactac
tatgagtacttcgctcctgattatcagcttgatgttcgcccctccaacatggacaacgcc
aacaccagagaatacctggacaagattcgcaaccaagttgttgaaaacctcaagcgcacg
gcatttgctccttcggtccaaatgacggatgtgccgcgaaaccccatcttggatggcatg
gacgacgaggctgacgacgttatggacgacctcgatgaggatgagaacaaagacaagcgg
ttcacacaacgacgattcgaccaacgcaccgaaaaggctggcgagcttagtgacagcgag
gatgaagccgagaacgccgccaacggcgttcgtcgccaaccaggcgccacgcgccgccgc
aaccaagtcaactaccgaaacctcgagccggactctgggctggatagtggcatggcaacc
ccgcaagatggctcatcagcggctgatggagaaatggattttgccattgattctaagatg
accgatgccccacgcactgaacccgaggctcctgatgctgatcacacggctatcgaaagt
gaggaacaggaagcctctactgcctctcaacaccagtctcctcccactcatgatgaagat
attacgatggaggatgctgctgtcgctgaacctattgccttggaacaggcttcgactcaa
gcgtcaatcgccgaggataaacatccggtcgagggctccaccgcctcccctgtgcgggcc
cattcccctccgaaagaggctgccggtcataccatcgagaagattgtcaaagcctctgct
cttactgcagacaacgaggccacggcaaccaaggaagagaacctggaacacatgtcagaa
cccaagaaagaggagtaa

DBGET integrated database retrieval system