KEGG   Pseudomonas sp. ATCC 13867: H681_02705Help
Entry
H681_02705        CDS       T02524                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
pdr  Pseudomonas sp. ATCC 13867
Brite
Translation factors [BR:pdr03012]
 Eukaryotic Type
  Elongation factors
   H681_02705
 Prokaryotic Type
   H681_02705
Mitochondrial biogenesis [BR:pdr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    H681_02705
Exosome [BR:pdr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   H681_02705
  Exosomal proteins of breast cancer cells
   H681_02705
  Exosomal proteins of colorectal cancer cells
   H681_02705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
601406..602599
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTKVCSDTWGGSARAFDQIDNAPEEKARG
ITINTSHVEYDSPVRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLNTYDFPGDDTPIVIGSALMALN
GQDDNEMGVSAVRKLVETLDSYIPEPVRAIDQPFLMPIEDVFSISGRGTVVTGRVERGIV
KVQEEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKREDVERGQVLAKPG
TIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNV
KMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaagtttgagcgtaacaagccgcacgttaacgtcggcaccatcggtcac
gttgaccacggtaaaaccactctgaccgctgctctgaccaaggtctgctccgatacctgg
ggcggctccgctcgcgctttcgaccagatcgacaacgcgccggaagagaaggctcgtggt
atcaccatcaacacctctcacgttgaatacgactcgccggtacgccactacgctcacgta
gactgcccgggccacgccgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggctgctgacggccccatgccgcagacccgcgagcacatc
ctgctgtcccgtcaggtaggcgttccctacattgtcgtgttcctgaacaaggccgacatg
gttgacgacgccgagctgctggaactggtcgaaatggaagttcgcgatctgctgaacacc
tacgacttcccgggcgacgacaccccgatcgtgatcggttccgctctgatggctctgaac
ggccaggacgacaacgagatgggcgtttccgccgtgcgcaagctggtagagaccctggac
tcgtacatccccgagccggttcgtgcaatcgaccagccgttcctgatgccgatcgaagac
gtgttctcgatctccggtcgtggcaccgtggtaactggccgtgttgagcgtggcatcgtc
aaggttcaggaagaagtggaaatcgtcggtatcaaggcgaccaccaagaccacctgcacc
ggcgttgaaatgttccgcaagctgctcgacgaaggtcgtgctggtgagaacgtcggcgtt
ctgctgcgtggcaccaagcgtgaagacgtagagcgtggtcaggttctggccaagccgggc
accatcaagccgcacaccaagttcgagtgcgaagtgtacgtgctgtccaaggaagaaggt
ggtcgtcacaccccgttcttcaagggctaccgtccgcagttctacttccgtaccaccgac
gtgaccggcaactgcgagctgccggaaggcgttgaaatggtaatgccgggcgacaacgtg
aaaatggttgtcaccctgatcgctccgatcgccatggaagacggcctgcgcttcgctatc
cgcgaaggtggtcgtaccgttggcgccggtgtggttgccaagatcatcgaataa

DBGET integrated database retrieval system