KEGG   Paenibacillus durus: PDUR_06235Help
Entry
PDUR_06235        CDS       T03297                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pdu  Paenibacillus durus
Pathway
pdu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pdu00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    PDUR_06235
Enzymes [BR:pdu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PDUR_06235
DNA repair and recombination proteins [BR:pdu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PDUR_06235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AIQ11592
UniProt: A0A089HKF6
LinkDB All DBs
Position
complement(1326637..1327575)
Genome map
AA seq 312 aa AA seqDB search
MKFQPIIPFEPIIADRLPAGEQWIAQIKWDGVRMISYYDGNSTELINRRGNNRTRQYPEL
ADAGRYCRAGSAILDGEVIALSGGKPSFHEVMRRDSLKKDSAIASMVRQIPVLYMVFDIV
YCNGEWLLDRPLSERQHLLEEMLLPHPHVQAVPSYSDPAALFSTARTNGLEGIVCKDVTS
VYTPGGKDKRWLKCKIIGDLNAVAGGVTFRDGTVNALLLGLYDADERLHYIGHAGTGRLT
VKDWRDLTALARSLAIDDMPFASLPQRVKGAFWIRPELVFKIHFLEWNTSGTLRQPSIQA
RVDVSPEECRLP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcagcccattattccgtttgagccgatcattgcagaccgtctgcctgcggga
gaacagtggattgcccagatcaaatgggacggcgttcgcatgatctcctactatgacgga
aattccaccgagctgatcaaccggcggggaaataaccgcacgagacagtatccggaactg
gccgatgccggccgctactgcagggccggttccgctattttggatggtgaagtcatcgcc
ctcagtgggggaaagccatcttttcatgaggtcatgcgccgggacagtctgaagaaagat
tccgctattgcttccatggtgcggcagattccggttctgtacatggtgttcgacattgta
tattgcaacggagagtggcttcttgaccggccgttatccgaacgccagcatctgctggaa
gaaatgctcctgcctcatcctcatgtgcaggccgtgccgagctacagcgatcccgccgcg
ctcttttccaccgcccgtaccaacgggcttgagggcatcgtctgcaaggatgttaccagt
gtctatacaccaggcggaaaagacaagcgctggctcaaatgtaaaattatcggagatctc
aatgccgtcgccggaggcgtcacatttcgggacggaaccgttaatgctctgctgctcggc
ttgtatgacgctgacgaacggctgcattatatcggacatgcgggaacagggaggctgacc
gtgaaggattggcgggatttaaccgctctcgcgcgcagccttgccatagacgatatgccg
tttgcttcactgccgcagcgggtcaagggcgcgttctggatcaggccggagctagtgttc
aagatccactttttagaatggaacacatcgggtacactgcgccaacccagcattcaggca
agagttgatgtttctcccgaagagtgccggctgccgtaa

DBGET integrated database retrieval system