KEGG   Pseudonocardia sp EC080619-01: AD017_05660Help
Entry
AD017_05660       CDS       T04234                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
pecq  Pseudonocardia sp EC080619-01
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ALL80820
UniProt: A0A0N7JYZ3
LinkDB All DBs
Position
1230545..1231516
Genome map
AA seq 323 aa AA seqDB search
MAASAGEPVELTIGDRVVRLSSPDRVYFPARGETKRDLAAYYESVGDGIVRALRDRPCML
HRFPTGVTGEKVHQKRLPRGAPDWVRTVRVHFPRFNRTADELCVGHLADVVWAVQMSTVE
FHPWNSRAADVESPDEWRIDLDPMPSAGWGDVRRVAGVVHEVLDELGATGFPKTSGGSGL
HVYVRIPPDHGFADVRRAAHAFAREVGRRCDRVDLSWWRKDRDPSAIFVDYNQNARDHTI
ACAYSVRGTPDARVSAPVRWDEIDACEPGDFTIATMPARYAELGDLHAGIDEAVFAIDPL
LEWADRDARDGAPPPDLPDLDDA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtggccgccagcgcgggtgagccggtcgagctgacgatcggcgaccgcgtcgtgcggctg
tccagcccggaccgcgtctacttcccggcccggggcgagaccaagcgggacctggccgcg
tactacgagtccgtgggcgacggcatcgtccgcgcgctccgcgaccggccctgcatgctg
caccggttccccaccggcgtcaccggggagaaggtgcaccagaagcggctgccgcgcggt
gccccggactgggtccgcacggtgcgcgtgcacttcccgcgcttcaaccgcaccgcagac
gagttgtgcgtgggccacctcgccgacgtcgtgtgggcggtgcagatgtccaccgtcgag
ttccacccgtggaactcccgcgcggccgacgtcgagtcccccgacgagtggcggatcgac
ctcgacccgatgccctcggccggctggggcgacgtgcggcgggtcgccggggtcgtgcac
gaggtgctcgacgagctcggcgccaccggcttcccgaagacgtccggcgggtccgggctg
cacgtctacgtccggatcccgccggaccacgggttcgccgacgtccgccgggcggcgcac
gcgttcgcccgcgaggtcggccggcgctgcgaccgggtcgacctgtcctggtggcggaag
gaccgggacccgtcggcgatcttcgtcgactacaaccagaacgcccgcgaccacacgatc
gcctgcgcctactcggtgcgcggcacgcccgacgcgcgggtgtcggccccggtccgctgg
gacgagatcgacgcctgcgagcccggcgacttcaccatcgccacgatgcccgcccggtac
gccgagctgggcgacctgcacgcgggcatcgacgaggccgtcttcgccatcgacccgctg
ctggagtgggcagaccgcgacgcccgcgacggcgcccctcccccggacctccccgacctc
gacgacgcgtga

DBGET integrated database retrieval system