KEGG   Pseudonocardia sp EC080619-01: AD017_07065Help
Entry
AD017_07065       CDS       T04234                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pecq  Pseudonocardia sp EC080619-01
Brite
Enzymes [BR:pecq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AD017_07065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1547714..1548313
Genome map
AA seq 199 aa AA seqDB search
MAEYTLPDLPYDYGALAPHIAPEIMELHHSKHHNTYVQGLNGTIDKLAEAREKNDFGAVV
GLEKTLAFNLGGHVNHSAFWKNLSPDGGDKPTGDLASAIDNDFGSFDAFQAHFTAAATTI
QGSGWAILGFDQLGQKLLIHQLYDQQSQLPAGQTPIVLLDMWEHAFYLQYKNVKPDYVKA
WWNVVNWADAAERFAAAKG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtacacgctcccggatctgccgtacgactacggcgcactcgctccgcacatc
gcgccggagatcatggagctgcaccactccaagcaccacaacacctacgtccagggcctc
aacggcaccatcgacaagctcgccgaggcccgggagaagaacgacttcggcgccgtcgtc
ggcctggagaagaccctcgcgttcaacctcggcgggcacgtcaaccactccgccttctgg
aagaacctctccccggacggcggcgacaagcccaccggtgacctcgcctccgcgatcgac
aacgacttcgggtcgttcgacgcgttccaggcgcacttcaccgccgccgccaccaccatc
cagggctccggctgggccatcctgggcttcgaccagctcgggcagaagctgctgatccac
cagctctacgaccagcagtcccagctccccgccgggcagaccccgatcgtgctgctcgac
atgtgggagcacgcgttctacctgcagtacaagaacgtgaagccggactacgtcaaggcc
tggtggaacgtcgtcaactgggcggacgccgccgagcgcttcgccgccgcgaagggctga

DBGET integrated database retrieval system