KEGG   Pseudonocardia sp EC080619-01: AD017_08835Help
Entry
AD017_08835       CDS       T04234                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pecq  Pseudonocardia sp EC080619-01
Pathway
pecq00250  Alanine, aspartate and glutamate metabolism
pecq00410  beta-Alanine metabolism
pecq00640  Propanoate metabolism
pecq00650  Butanoate metabolism
pecq01100  Metabolic pathways
pecq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pecq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AD017_08835
   00650 Butanoate metabolism
    AD017_08835
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AD017_08835
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AD017_08835
Enzymes [BR:pecq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AD017_08835
Amino acid related enzymes [BR:pecq01007]
 Aminotransferase (transaminase)
  Class III
   AD017_08835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ALL81274
UniProt: A0A0P0SAU8
LinkDB All DBs
Position
complement(1923843..1925099)
Genome map
AA seq 418 aa AA seqDB search
MAQLSPLLKQATPVQAARGEGVYLYDTDGRRHLDFTAGIGVTSTGHCHPTVVKAAQEQVG
TLIHGQYTTVMHQPLLKLVERMGEVLPEGIDSVFFTNSGSEAVEASVRLARQATGRSTIV
AFDGGFHGRTMGAAALTTSGAKIRAGIGPMMGGVAFSPFPYAYRYGWSEEDTVAFALREL
DRVLASSAPASDVAAFIVEPVLGEGGYVPTPSAFLHGLRERADKHGILLIADEVQTGYGR
TGRFWGHQHAEGFTPDVIVTAKGLASGFPLSAIAAPKAIMEKAWPGSQGGTYGGNAVACA
AALATLDVVQGEGLVENARVQGEKLVAGVRDAAQGIAAIGDVRGRGLMVGIEFVDAAGNP
DGATAAKVHAAAAAQGLLLLTCGVQGNIVRMIPPLVVTGEQIDEGLALWTKALDDALS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctgtccccgctgctgaagcaggccaccccggtccaggccgcccgcggtgag
ggcgtctacctgtacgacaccgacggccgccggcacctcgacttcaccgccggaatcggc
gtcacgtccaccgggcactgccacccgacggtcgtcaaggcggcgcaggagcaggtcggc
accctgatccacggccagtacacgaccgtcatgcaccagccgctgctgaagctggtcgag
cggatgggcgaggtcctgcccgagggcatcgactcggtcttcttcaccaactccggttcg
gaggccgtcgaggcctcggtgcggctcgcgcgccaggccaccggccgctccacgatcgtc
gccttcgacggcgggttccacggccgcacgatgggcgccgcggcgctcaccacctccggt
gcgaagatccgcgccgggatcggcccgatgatgggcggggtcgcgttctccccgttcccc
tacgcctaccgctacggctggtcggaggaggacaccgtcgcgttcgcgctgcgcgagctc
gaccgggtcctggccagctccgcgccggcgtcggacgtcgcggccttcatcgtcgagccg
gtgctcggcgagggtggctacgtcccgaccccgtccgcgttcctgcacggtctgcgggag
cgggccgacaagcacggcatcctgctgatcgccgacgaggtgcagacgggctacggccgc
accggcaggttctggggtcaccagcacgccgagggcttcacgccggacgtcatcgtcacc
gcgaaggggctcgcgtccgggttcccgctgtccgcgatcgccgcgccgaaggcgatcatg
gagaaggcctggccgggctcgcagggcggcacctacggcggcaacgccgtcgcctgcgcc
gcggccctggccaccctggacgtcgtgcagggcgagggtctcgtcgagaacgcccgggtg
cagggcgagaagctcgtcgccggggtccgggacgcggcgcaggggatcgccgcgatcggc
gacgtccgcggccgtggcctgatggtcggcatcgagttcgtcgacgccgcgggcaacccg
gacggcgccaccgcggcgaaggtccatgccgccgcagccgcgcagggtctgctcctgctg
acctgcggcgtccagggcaacatcgtccggatgatcccgccgctggtcgtcaccggcgag
cagatcgacgagggcctcgcgctctggaccaaggcgctcgacgacgcgctgtcctga

DBGET integrated database retrieval system