KEGG   Pseudonocardia sp EC080619-01: AD017_20345Help
Entry
AD017_20345       CDS       T04234                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
pecq  Pseudonocardia sp EC080619-01
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALL82947
UniProt: A0A0P0SF44
LinkDB All DBs
Position
complement(4345001..4346491)
Genome map
AA seq 496 aa AA seqDB search
MSITSDTRAPLTRLDRFYIGGEWVAPSSSDTISVIEPATEQVYYQVPEAQNADVDRAVTA
ARAAFDEGPWPTMTHGRRAEFLRAIGAAVRERSDDVTQVWPRESGIVLGAAQAMIGGVPD
AYGFYADLADTFAFEEPATPTAGGTYGMISREPVGVVGAIIPWNAPMTLIAYKLAPALLA
GCTVVLKASPEAPGAPYIMAEIAEKIGLPPGVLNVLTADREVSESLVRDPRVDKIAFTGS
TAAGRRIASVLGERIGRYTLELGGKSAAVVLDDMDLGEAAASLSGAECFLSGQVCSSLTR
IVVPRRRHDELADALAGTFSQVKLGDPFDPGVQMGPLAMERQRDRVEGYIAQGVAEGARL
VTGGGRPKDLDRGWFIEPTVFSGVDNSWKIAQEEIFGPVLSVIPAEDEEDAIRIANDTIY
GLNAAVFTHDADRAREVAGRLRAGTVGHNNFRTDFGIGFGGFKQSGTGREGGVDGLLPYL
ENKTMIFEEKPRDFPG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaccagcgacacgagggcccctctcacgaggctcgacaggttctacatcggc
ggcgagtgggtcgcaccgtcgtcgagcgacaccatctcggtgatcgagcccgccaccgag
caggtctactaccaggtccccgaggcgcagaacgccgacgtcgaccgcgcggtcaccgcg
gcccgggccgccttcgacgagggcccgtggccgacgatgacgcacggccggcgcgcggag
ttcctccgcgcgatcggggcggcggtacgtgagcgttccgacgacgtcacgcaggtctgg
ccgcgggagtccggcatcgtgctcggcgccgcgcaggcgatgatcggcggggtcccggac
gcctacggcttctacgccgacctcgccgacacgttcgccttcgaggagcccgccacgccg
accgcgggcgggacgtacggaatgatctcccgagagccggtcggggtggtcggcgcgatc
atcccgtggaacgctccgatgacgctgatcgcctacaagctggcacccgcgctactggcc
ggctgcaccgtcgtcctcaaggcctcgcccgaggcccccggcgccccgtacatcatggcc
gagatcgccgagaagatcggcctgccgcccggggtgctcaacgtcctcaccgcggaccgc
gaggtctccgagagcctggtccgcgacccgcgcgtcgacaagatcgccttcaccggctcg
acggcggccggccggcggatcgcctccgtcctcggcgagcgcatcggccgctacaccctc
gagctcggcggcaagtccgccgcggtcgtcctcgacgacatggacctgggcgaggcagcc
gccagcctgtccggcgcggagtgcttcctctccgggcaggtgtgctcctccctgacccgc
atcgtcgtcccgcgccgccgccacgacgagctggccgacgccctcgcagggacgttctcc
caggtcaagctgggcgaccccttcgacccgggcgtccagatgggaccgctcgcgatggaa
cgccagcgcgaccgggtcgagggctacatcgcccagggcgtcgccgagggcgcgcggctg
gtgaccggcggcgggcgtccgaaggacctcgaccgcggctggttcatcgagccgacggtg
ttctccggcgtcgacaactcctggaagatcgcccaggaggagatcttcggcccggtgctc
tcggtcatcccggccgaggacgaggaggacgcgatccggatcgccaacgacacgatctac
gggctcaacgccgcggtcttcacccacgacgccgaccgggcgcgcgaggtggccggacgg
ctgcgggccgggacggtcgggcacaacaacttccgcaccgacttcggcatcggcttcggc
gggttcaagcagtccgggaccggccgcgagggcggcgtggacggtctgctcccgtacctg
gagaacaagaccatgatcttcgaggagaagccgcgcgacttcccgggctga

DBGET integrated database retrieval system