KEGG   Peptoniphilus sp. 1-1: ING2D1G_0404Help
Entry
ING2D1G_0404      CDS       T03807                                 

Gene name
tuf1-1
Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ped  Peptoniphilus sp. 1-1
Brite
Translation factors [BR:ped03012]
 Eukaryotic Type
  Elongation factors
   ING2D1G_0404 (tuf1-1)
 Prokaryotic Type
   ING2D1G_0404 (tuf1-1)
Mitochondrial biogenesis [BR:ped03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ING2D1G_0404 (tuf1-1)
Exosome [BR:ped04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ING2D1G_0404 (tuf1-1)
  Exosomal proteins of breast cancer cells
   ING2D1G_0404 (tuf1-1)
  Exosomal proteins of colorectal cancer cells
   ING2D1G_0404 (tuf1-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CDZ74588
UniProt: A0A090HZ05
LinkDB All DBs
Position
I:420167..421357
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITLVMNKRYGGGEFVDYAHIDKAPEERER
GITISTSHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLARQVGVPQIVVFLNKEDQVDDEELIELVEMEVRDLLSEYDFDGDNTPIVVGSALKAL
EDPDGEWGDKIVKLMEEVDAYIPEPVRDVDHPFLMPVEDIFSITGRGTVATGRIERGTVK
VGDNVEVVGLTDEKRTVVVTGVEMFKKQLDDARAGDNIGALLRGVQRSEIERGQVLAAPN
SIKPHTKFQAEVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGDIQLPEGVEMVMPGDNA
TFTVDLITPIAMDEGLRFAIREGGRTVASGVVTKLL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagctaaatttgaaagaaccaaaccccacgtaaacataggtacaataggacac
gtagaccacggaaaaacaacactgacagcagcaataacccttgtaatgaacaaaagatac
ggcggaggagaattcgtagactacgcccacatagacaaagccccggaagaaagagaaaga
ggaatcaccatctcaacctcacacgtagaatacgaaacaccaaacagacactacgcccac
gtagactgcccgggacacgccgactacgtaaagaacatgataacaggcgcagcacaaatg
gacggagcaatccttgtagtatcagcagcagacggaccaatgccccaaacaagagaacac
atactattagcaagacaagtaggcgtaccccaaatagtagtattcctaaacaaagaagac
caagtagatgacgaagaactaatcgaattagtagaaatggaagtaagagacctactatca
gaatacgactttgacggagacaacaccccaatcgtagtaggaagcgccctaaaagcctta
gaagacccggacggagaatggggagacaaaatagtaaaactgatggaagaagtagacgcc
tacattcccgaaccggtaagagacgtagaccatcccttcctaatgcccgtagaagacatc
ttctcaatcacaggaagaggaacagtagcaacaggaagaatcgaaagaggcacagtaaaa
gtaggcgacaacgtagaagtagtaggcctaacagacgaaaaaagaacagtagtagtaacc
ggagtagaaatgtttaaaaaacaattagacgacgcaagagccggagacaacatcggagcc
ctactaagaggagtacaaagaagcgaaatcgaaagagggcaagtcttagcagcccccaac
tcaataaaaccccacacaaaattccaagcagaagtatacgtactgacaaaagaagaaggc
ggaagacacaccccatttttcaacggttatagaccacaattctacttcagaacaacagac
gtaacaggcgacatccaactccccgaaggagtagaaatggtaatgcccggagacaacgca
accttcacagtagacctgatcacacccatagcaatggacgaaggcttaagatttgcaata
agagaaggcggaagaacagtagcatcaggagtagtaacaaaattactataa

DBGET integrated database retrieval system