KEGG   Pelobacter sp. SFB93: A7E78_02815Help
Entry
A7E78_02815       CDS       T04594                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pef  Pelobacter sp. SFB93
Pathway
pef00473  D-Alanine metabolism
pef00550  Peptidoglycan biosynthesis
pef01100  Metabolic pathways
pef01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pef00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A7E78_02815
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A7E78_02815
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A7E78_02815
Enzymes [BR:pef01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A7E78_02815
Peptidoglycan biosynthesis and degradation proteins [BR:pef01011]
 Precursor biosynthesis
  Amino acid ligase
   A7E78_02815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 GARS_A ATPgrasp_Ter CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: APG26862
UniProt: A0A1L3GLR0
LinkDB All DBs
Position
complement(606235..607305)
Genome map
AA seq 356 aa AA seqDB search
MHIALTFNLRQDSACAPSNSPSVAPLAAAEDLYAEWDDFDTIDAVRSALSQCHRVSLVEA
DHYAFASFQALRPDLVFNMAEGLLGASREAQIPALLDMLGLPYTGSDPLTLGNCLDKRRT
KEILSYHRVPTPRFALVESLVDVPARLRYPLIVKPILEGSSKGVTDRALVTNRKELLRQV
EWSLKTYRQPVLIEEFLPGREFTVALLGNGESLRILPVVEIDFAALPAGVNPIYSFEAKW
IWDTEEQPLDIFACPAPLDPSLHNAIERVCKKAFQVMGCRDWCRIDVRLDASGQPNIIEL
NPLPGVLPRPEQNSCFPKAARAAGLSYDELILGVADAAIARHHLVKGVSHADCCLL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcgcgctcacgttcaatctgcgccaggattccgcctgcgcgccatccaattcg
ccctccgtcgctcctcttgccgcagcggaagacctctacgccgagtgggacgatttcgac
acgatcgatgctgttcgctccgccctttctcaatgccaccgggtatccctggtggaggcc
gaccattacgcctttgccagctttcaggctctgcgaccggacctggtgttcaacatggcc
gaaggtctgctcggtgccagccgcgaagcccagatccctgccctgctcgacatgctcggc
ttgccttacaccggcagcgatccgctgaccctcggcaactgtctggacaaacgccgcacc
aaggagattctcagttaccatagggtgccgacgccacgcttcgccctggtagagagtctg
gtagatgttccggcccggttgcgctatccgctgatcgtcaaacccattctggaaggctcc
agcaagggagtcaccgaccgcgctctggtgactaaccgcaaggagttgctgcgtcaggtg
gaatggtcgctgaaaacgtaccgtcagccggtgctgatcgaagagtttctgcctggtcgt
gagttcaccgtggcgctgctcggaaacggcgaatctctgcgtatactgcccgttgtcgag
atcgacttcgccgctttgccggccggggtcaatcctatctattcttttgaggccaaatgg
atctgggacaccgaagagcaacccttggatatttttgcctgcccggcacctcttgatccg
tcgctgcacaatgccatcgaaagggtttgcaaaaaggcctttcaggttatgggctgtcgg
gactggtgccgcatcgatgtgcgcctcgacgccagcggtcagccaaacattatcgaactc
aatcccctgcccggcgtgctgcctcgccctgagcagaacagctgtttccccaaggcggcc
cgcgcagcgggtctgtcttacgacgagttgattctcggtgtggctgatgcggccattgcc
cgtcaccatctggttaagggggttagccatgcggattgctgtctgctttaa

DBGET integrated database retrieval system