KEGG   Pseudomonas entomophila: PSEEN0475Help
Entry
PSEEN0475         CDS       T00362                                 

Gene name
tufB
Definition
(GenBank) protein chain elongation factor (EF-Tu-B)
  KO
K02358  
elongation factor Tu
Organism
pen  Pseudomonas entomophila
Brite
Translation factors [BR:pen03012]
 Eukaryotic Type
  Elongation factors
   PSEEN0475 (tufB)
 Prokaryotic Type
   PSEEN0475 (tufB)
Mitochondrial biogenesis [BR:pen03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PSEEN0475 (tufB)
Exosome [BR:pen04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PSEEN0475 (tufB)
  Exosomal proteins of breast cancer cells
   PSEEN0475 (tufB)
  Exosomal proteins of colorectal cancer cells
   PSEEN0475 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
498083..499276
Genome map
AA seq 397 aa AA seqDB search
MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAVVEFDKIDSAPEEKARG
ITINTAHVEYNSNIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSARMALE
GKDDNEMGTTAVKKLVETLDAYIPEPVRAIDQPFLMPIEDVFSISGRGTVVTGRIERGIV
RVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
SVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
QMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaagtttgatcgttccctacctcacgtcaacgtcggcaccatcggccac
gtagaccacggtaagaccactctgactgcagcgctgactcgcgtctgctccgaagttttc
ggttcggccgtcgttgagttcgacaagatcgactcggctccagaagaaaaagcgcgcggt
atcaccatcaacaccgctcacgtcgagtacaactcgaacattcgtcactacgctcacgtt
gactgcccaggtcacgctgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggccgccgatggtccgatgccacaaacccgtgagcacatc
ctgctgtctcgtcaggttggcgttccgtacatcgtggtcttcctgaacaaggctgacctg
gtagatgacgctgagctgctggaactggtcgagatggaggttcgcgacctgctgtccacc
tacgacttcccaggcgacgacaccccgatcatcatcggttcggctcgtatggcgctggaa
ggcaaagacgacaacgaaatgggcactaccgctgtcaagaagctggtagaaactctggat
gcctacattcctgagccagttcgtgccatcgaccagccgttcctgatgccgatcgaagac
gtattctcgatctcgggtcgtggtaccgttgttaccggccgtatcgagcgtggtatcgtc
cgcgttcaagacccgctggaaatcgttggtctgcgtgacaccaccaccaccacctgcacc
ggcgttgagatgttccgcaagctgctggacgaaggtcgtgctggcgagaactgcggcgtc
ctgctgcgtggtaccaagcgtgacgacgttgagcgtggccaggttctggtcaagccaggt
tcggtcaagccgcacaccaagttcaccgcagaagtctacgtcctgtcgaaggaagaaggc
ggccgtcacactccgttcttcaaaggctaccgtcctcagttctacttccgtaccactgac
gtgaccggtaactgcgaactgccggaaggcgttgaaatggtaatgccaggtgacaacatt
cagatgactgtcaccctgatcaagaccatcgcaatggaagacggtctgcgcttcgccatc
cgtgaaggcggtcgtaccgtcggcgccggcgtcgtagcaaaaattattgaataa

DBGET integrated database retrieval system