KEGG   Pseudomonas entomophila: PSEEN1815Help
Entry
PSEEN1815         CDS       T00362                                 

Gene name
psvA
Definition
(GenBank) pyoverdine synthetase A
Organism
pen  Pseudomonas entomophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1892010..1904957
Genome map
AA seq 4315 aa AA seqDB search
MTDAFELPHSLVQALAQRAARTPDRIALRFLADAPGEQAVLSYRDLDQRARTIAAALQAR
AGFGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESSRQHHQERLLSIIADAEPRLL
LTVEALCDSLQGLEALTGSQAPGMLAVDRLLPSLADEWQEPALADDDIAFLQYTSGSTAL
PKGVQVSHGNLVANEQLIRHGFGIDVNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPGYFLARPLRWLQAISEYGGTISGGPDFAYRLCSERVSEAALAGLDLSRWRVAYSGSE
PIRQDSLDTFAEKFAACGFDASSFFASYGLAEATLFVSGSRRGQGIGALELDAEAFAANR
AEPGQGSVVMSCGYPQPGHAVRIVEPQHLEVLDDNLVGEIWAGGPSIALGYWRNPEASAR
TFVEMDGQTWLRTGDLGFMRDGEVFVTGRLKDMLIVRGQNLYPQDLEKTLEREVEVLRKG
RVAVFAVDDQGEEGIGVAVEISRNVQKSTPPETLINTLRRVIADACRQAPAVVLLLNPGA
LPKTSSGKLQRSACRLRMNDGSLDCYARFPAHTQASTGEVGGDELQARIAAVWRELLKVE
AVAADDHFLLLGGNSIAATQVTARLSDELGVALSLRTLFEAPTLAEYSAAVAAMLAEGGE
GVGRIALQGRDQALPQSLAQNRLWLMWQLEPQSAAYNIPAGLHLRGELDEAALEASFQAL
VARHESLRTVFDEVDGQALQRILPSLPFAVQRLDLEGLGADEVTARREREAQQPFDLRVG
PLLRVTLARLDDESHQLWVTLHHIVADGWSLNILLDEFARLYAAQGQAMNLAELPLGYAD
YGNWQRQWLAEGEAARQLAYWTDTLGDELPVLDLCTDQPRGKQRKHSAARLSLKVPAKLG
GALKDLARDRQASLFMVLLAGWQALLHRYTGQGDIRVGVPNANRPRLETQGMVGFFINTQ
VLRTELDGRLPFEQLLAQVRQATLGAQAHQDLPFEQLVEALPQAREQGLFQVMFNHQQRD
LSALRRLPGLLAEELPWHSREAKFDLQLHSEEDHQGRLTLAFDYADELFDTSTIKRLANH
LLALLEQVCAQPALALGEVRLLDQAGRAQLLAWGQAPMAPAPRLLVEQLNEQARLTPERT
ALVWEGGQLDYAELHQQANRLAHYLRDKGVGPDTCVAIAIERSPQLLVGLLAILKAGGAY
VPLDVDYPAERLAYMLGDCKAGLLLSHSSLLERLPQVDGVSAIALDQLHLDSWPSQAPGL
HLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLHWMQATYALDGSDVLMQKAPISFDVS
VWECFWPLITGCRLVLAGPGEHRDPQRIAQLIQQHQVTTLHFVPPLLQVFVQEPLAAGCT
SLRRLFSGGEALSAALRDRVLQLLPQVQLHNRYGPTETAINVTHWHCQGSDGERSPIGRP
LGNVLCRVLDDEFELTAPGVPGELCLGGVGLARGYLGRPGLTAERFVPQPDGDGARLYRS
GDRARWHVQDEALDYLGRLDQQVKVRGFRVEPEEVQAVLLAQPGVEQALVLIHKDAVGAQ
LVGYYSGGAQHDRLLAALGERLPAYMVPAQLIPLAQMPLGPSGKVDRKALPAPVWQQREH
VAPQSELQKQVAAIWREVLNLPQVGLQDDFFALGGHSLLATQIVSRTRQALDVELPLKAL
FEASELGAFCAEIARLRDSGERNLQGAIARVDRRQAVPLSYSQQRMWFLWQMEPDSPAYN
VGGMARFKGVLHVDAFERALQALIVRHETLRTTFPSIDGKPYQCVAGDSNLQLHWHDFSS
DAAEVRQQRLQQLADDQAHQPFDLERGPLLRACLVKADEREHYFVLTLHHIVTEGWAMDI
FARELGELYEAFVDERESPLAPLPVQYLDYSVWQRQWLEGGEGARQLAYWKDRLGDEHPV
LALPADRPRPAVQSHRGELYRFDLAPALVERVHAFNSQRGLTLFMTMTATLAALLHRYSG
QRDLRIGAPVANRIRPESEGLIGAFLNTQVLRCEVDGQMSVSALLDQVRTAIIDGQSHQD
LPFEQLVEALQPPRSSAYNPLFQVMCNVQRWAFQQSRELVGMQVDYLVNDASATKFDLYL
EVTDLDGRLGCCFTYSRDLFDEPRIARMAEHWQHLLVALLDDPRQRLCELPMLAEAEQQV
LVGQLQGEQDFELTQTLHGLFAAQAERTPQALALTFAGTHLSYAELDQQANRLARALRER
GVGPQVRVGLALERSLEMVIGLLAILKAGGAYVPLDPEYPLDRLRYMIEDSRIGLLIGQR
ALLDTLGELPDGVARWSLEDDAASLAAYSDAPLDNLNLPQHQAYLIYTSGSTGKPKGVVV
SHGEIAMHCQAVIAEFGMRSDDCELHFYSINFDAASERLLTPLLCGARVVLRAQGQWGAE
EICQLVREQQVSILGFTPSYGSQLAQYLAGQGEQLPVRLVITGGEALTGEHLQRIRQAFV
PQQFFNAYGPTETVVMPLACLAPDTLPADAGSVPIGRVIGARTAYILDEDLALLPQGGIG
ELYVGGAGLAQGYHDRPGLSAERFVADPFSHDGGRLYRTGDLVRLRADGLVEYVGRADQQ
VKIRGFRIELGEIESRLQEHADVEEAVVLALDLPGGKQLVGYLVCPQAKGTADAQAVLRE
AVKAEARLHLPDYMVPAHLVLLERLPLMGNGKLDRRALPAPDLEQARQHYQAPANELETQ
LAQVWREVLNVSRIGVQDNFFELGGDSILSIQVVSRARQLGLQFTPRDLFQHQTIQTLAA
VVTRSEAPSDIEQGQRQGRTGLTPIQHWFFDSEVPQPQHWNQAVLLQALQPLRTEVLEQA
LNALVAHHDSLRLHFEQHNGRWQGSYGQPTAQPLLWTATVSDLDDCQALYTDVQRSLDLA
QGPLLRALLVTDGQGAQRLLLAIHHLVVDGVSWRVLLEDLQALYRGETLAAKTHAMGDWA
ERLASYAGSDSLRDELGWWEGQLGSARHELPCDHPQGESLNRHARSVAIELDVEQTRQLL
QQAPAAYHTQVNDLLLTALARTLCRWSGDEQVLVQLEGHGRDGLFEDMDLTRSVGWFTNA
YPLSLSPAVGEDEVARAASIKRIKEQLRQVPHKGQGYGVLRYLADDADRERMAALPQARI
TFNYLGQFDQQFDAAALFQPLDAPAGLAHDLDAPLPNWLSVDGQVYGGALQLRWSFSAER
YDEATIAQLAEAYRQELLAVVAHCLADGNGSFTPSDFPLAQLTQEQIDTLPVPATEIEDV
YPLTPMQEGLLLHTLLEPGTGLYYMQDRYRINSALDPERFAQAWQAVVARHEALRASFSW
NAGEAMLQIIHKPGHTPVDYQDWRGLDEATQEARLQALHKQEREAGFELLREAPFHLRLV
RVDEARYWFMMSNHHILIDAWCRSLLMNDFFELYQALGEGRQAQLPVPPRYRDYIGWLQR
QDLAEARQWWQDNLAGFERATAIPSDRPLRHDHAGDGMVVGDCYTRLDVAEGARLRELAQ
AHQLTVNTFAQAAWALTLARYSGERDVVFGVTVAGRPVSLPQMQRTVGLFINSIALRVQL
PQPGERASVRQWLQGLLDRNMQLREYEYLPLVAIQECSELPKGQPLFDSLFVFENAPVET
AVLDHAQHLNASSDSGRTHTNFPLTAVCYPGDDLGLHLSFDQRYFDYPTVERLLAEFKRL
LLALVEGFDGEVGELPLLGAEEQRFLLDDCNRTEHAYELEQSYVELFEARVAAHPQRTVA
RCLDAAFDYAGLNLAANRLGHALMAAGVAVDQPVALLAERGLALLGMIVGSFKAGAGYLP
LDPGLPSARLQRIVELSRTPVLVCSAACAEQARVLLDEVAGAVRPKLLVWEEVQASNVAS
HNPGIHSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLALDEQDVIAQTASQ
SFDISVWQFLAAPLFGARVEIVPNAIAHDPQGLLAHVQATGITVLESVPSLIQGMLANDH
QALDGLRWMLPTGEAMPPELAAQWLQRYPAIGLVNAYGPAECSDDVAFFRVDLESTQGSY
LPIGTPTDNNRLYLLGEDQTLVPLGAVGELCVAGTGVGRGYVGDPVRTAQAFIPHPYGAP
GERLYRTGDLARRRADGVLEYVGRIDHQVKIRGYRIELGEIEARLHEQQELRDAAVGVQE
GANGKHLVGYLVAHQGVEADAALLDQFKQRLRAELPEYMVPLHWGWFDSLPHNANGKLDR
KALPAIDIGGQHSQDYLAPRNELEETLAGIWADVLKAERVGVRDNFFELGGHSLLATQIA
SRVQKALQLNVPLRAMFECSTVEELAAYVQGLQGSALDDDKVDRLSDLMAELEAL
NT seq 12948 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgccttcgaactcccgcactcgctggtccaggccctggcgcaacgcgccgcc
cggaccccggaccggatcgccttgcgcttcctggccgatgcgcccggcgagcaggccgtg
ctcagctaccgggacctcgaccaacgcgcccgcaccatcgcggccgcgttgcaggccagg
gcaggtttcggcgaccgcgcggtgctgctgttccccagtgggccggactatgtcgcggcg
ttcttcggctgcctctatgccggggtcatcgccgtgccggcctacccaccggagtcctcg
cgccagcaccaccaggagcggctgctgtcgatcatcgccgacgccgagccgcgcctgctg
ctgacggtagaagcgctgtgtgacagtttgcagggcttggaggcgctcaccggcagccaa
gctcctggcatgctggcggtggaccgtttgctcccgtccctggccgacgaatggcaagag
ccggcgctggccgacgatgacatcgccttcctgcagtacacctccggctccaccgcgctg
cccaagggcgtgcaggtcagccatggcaacctggtggccaacgaacaactgatccgccac
ggttttggcatcgatgtgaaccctgacgatgtgatcgtcagctggctgccgctgtatcac
gacatgggcctgatcggcggcctgctgcagccgatcttcagcggtgtaccgtgcgtgctg
atgtcgccgggttacttcctcgcccggccgctgcgctggttgcaggcgatcagcgagtac
ggcggcaccatcagcggcggcccggacttcgcctaccgcctgtgcagcgaacgggtcagc
gaggcggcgttggccgggctcgacctgagccgctggcgcgtggcctattcaggctccgag
ccgatccgccaggacagcctcgacaccttcgccgagaaattcgccgcctgtggcttcgac
gccagcagtttcttcgccagctacggcctggccgaagcgacgctgtttgtcagtggcagc
cgccgtggccagggcatcggtgccctggaactggacgccgaggccttcgccgccaaccgt
gccgagccgggccagggcagtgtagtgatgagctgtggctacccgcagccgggccatgcg
gtgcgcatcgtcgagccccagcacctggaggtgctggatgacaacctggtcggtgagatc
tgggcgggaggcccgagcattgccctgggctactggcgcaaccccgaggccagcgcccgt
accttcgtcgaaatggatggccagacctggctgcgcaccggcgacctgggcttcatgcgc
gacggcgaggtgttcgtcaccgggcgcctgaaggacatgctcatcgtccgtggccagaac
ctctacccgcaggacctggaaaagaccctggagcgtgaggtcgaggtgctgcgcaagggg
cgtgtcgcggtgttcgccgtcgacgatcagggcgaggagggcatcggcgtggcggtggag
atcagccgcaacgtgcagaagtcgacaccgcccgagacattgatcaacaccctgcgccgg
gtcatcgccgatgcctgccgccaggcgcctgcggtggtgctgctgctcaatcccggcgca
ctgcccaagacctccagcggcaagctgcagcgctcggcctgccgcctgcgcatgaacgac
ggcagcctggattgctacgcgcgcttcccggcgcacacccaggcatccaccggtgaagtc
ggtggtgacgagctgcaggcgcgcatcgccgctgtgtggcgcgagctgctcaaggtcgag
gcggtggcggcggatgatcacttcctgctgctgggtggcaattccattgccgcgacccag
gtgactgcgcgcctgtccgatgaactgggcgtggcgctgagcctgcgcacgctgttcgag
gcgccgaccctggccgaatactcggcggcggtggcggccatgctcgccgaaggcggtgag
ggtgtcgggcgcattgccctgcaaggccgcgaccaggccttgccgcaatcgttggcacag
aaccgcctgtggctgatgtggcaactcgagccgcaatcggctgcctacaacattcctgcc
ggcttgcacctgcgtggcgagctggacgaagccgcccttgaggcgagcttccaggccctg
gttgcacgccacgagtccctgcgcaccgtgttcgacgaagtcgatggccaggcgctgcag
cgtatcctgccgagcctgccgttcgccgtgcaacggctcgacctcgaagggctgggcgcc
gatgaagtgacggcgcgccgcgagcgcgaagcgcagcaaccgttcgacctgcgtgtcggc
ccgctgctgcgggtcaccctggcacgcctggacgacgaaagccatcagttgtgggtgacc
ctgcaccacatcgtcgccgatggctggtcgctgaacatcctgctcgacgagtttgcccgc
ctgtatgccgcgcaaggccaggccatgaacctggccgagctgcccctgggctacgccgac
tacggcaactggcagcgccagtggctggccgagggcgaggctgcacggcaactggcctac
tggaccgacacactgggcgatgaactgccggtgctcgacctctgcaccgaccagccacgc
ggcaaacaacgcaagcacagcgcggcgcgcctgagcctgaaggtaccggccaagctcggc
ggtgccctgaaagacctggcccgcgaccggcaggccagcctgttcatggtcctgctggcc
ggctggcaggcgctgctgcaccgctacaccggccaaggcgatatccgtgtcggtgtgccc
aacgccaaccgcccgcgcctggaaacccagggcatggtcggcttcttcatcaacactcag
gtgctgcgtaccgagctcgacggccgcctgccgttcgagcagctgctggcccaggtgcgc
caggccacgctcggggctcaggcccaccaggacctgccgttcgagcaactggtcgaagcc
ttgccccaagcccgggagcagggcctgttccaggtcatgttcaaccaccagcagcgcgac
ctttcggccctgcgccgcctgcccggcctgctcgccgaagagctgccgtggcacagccgc
gaagccaagttcgacctgcagctgcacagtgaggaggaccaccagggccgcctgaccctg
gccttcgactacgccgacgaactgttcgataccagcaccatcaagcgcctggccaatcac
ctgctggccctgctggagcaagtctgcgcccagccggcgttggcgctgggtgaagtgcgc
ctgcttgaccaggcgggccgcgcgcagctgctggcctgggggcaggcgccgatggcgccc
gcgccacgcttgctggtcgagcaactcaacgagcaggcccgcctgacccctgaacgcact
gcgctggtgtgggagggcggccagctcgactatgccgaactgcaccagcaggccaaccgc
ctggcccattacctgcgcgacaagggggtcggcccggacacctgcgtggccatcgccatc
gagcgttcgccgcaactgctggttggcctgctggccattctcaaggccggtggcgcttac
gtgccactggatgtcgactacccggccgagcgcctggcgtacatgctgggcgactgcaag
gccggcctgctgctcagccacagcagcctgctcgagcgcctgccgcaggtcgatggtgtc
agcgccatcgccctcgaccagctacatctggacagctggccaagccaggcccccggcctg
cacctgcatggcgacaacctcgcctacgtgatctacacctccggctcaaccggccagccc
aagggcgtcggcaacacccacgccgcgttggccgagcgcctgcactggatgcaggcgacc
tatgcgctggatggcagcgacgtgctgatgcagaaggcgccgatcagcttcgacgtctcg
gtgtgggagtgcttctggccgctgatcaccggttgccggctggtgctggccggccccggc
gaacaccgcgatccacaacgtattgcccagttgatccagcaacaccaggtgaccacgctg
cacttcgtaccaccgctgttgcaggtgttcgtccaggagccgcttgctgccggttgcacc
agcctgcgccggctgttctccggtggcgaggcgctgtctgcggcgttgcgtgatcgcgtg
ctgcaactgttgccgcaggtccagttgcacaaccgctacggcccgaccgaaaccgcgatc
aacgtcactcattggcattgccaaggcagcgatggcgagcgctcgccaatcggccggccg
ctgggcaatgtactgtgccgggtgctggacgacgagttcgaactcaccgcccccggcgtg
ccgggtgagctatgcctcgggggcgtgggcctggcccgtggctacctggggcgccccggg
ctgaccgccgagcgtttcgtgccccagcccgatggtgacggtgcgcgcctgtaccgcagc
ggcgaccgtgcccgctggcatgtacaagatgaggccctggactacctcggtcgtctcgac
cagcaggtcaaggtacgtggcttccgcgtcgagccggaggaagtgcaggccgtgctgctg
gcccagccgggggtcgaacaggccctggtgctgatccacaaggacgccgttggcgcccag
ttggtcggctactacagcggtggcgcgcaacacgacaggttgctggctgccctgggcgag
cgtctgccggcgtacatggtgcccgcccagttgatccctctggcgcagatgcccctgggg
ccaagtggcaaggtcgaccgcaaggcgctgccggcgccggtgtggcagcagcgcgagcat
gtcgcgccgcaaagcgaactgcaaaagcaggtcgccgccatctggcgcgaggtgctgaac
ctgccgcaggtcggtttgcaggatgacttcttcgccctcggcggccactcgctgctggcc
acccagatcgtttcgcgcacccgccaggcgctggatgtcgagctgccgctcaaggcgctg
ttcgaagccagcgagctgggggcgttctgcgccgagatcgcgcgcctgcgtgacagcggc
gaacgcaacctgcaaggtgcgatcgcccgggtggaccgccgccaggccgtgccgctgtct
tactcgcagcagcgcatgtggttcctctggcagatggagccggacagccccgcctataac
gttggcggcatggcgcggttcaagggcgtgctgcatgtggacgccttcgagcgggccctg
caggccttgatcgtgcgtcatgaaaccctgcgcaccaccttcccgagcatcgacggcaag
ccttaccagtgcgtggcgggcgacagcaacctgcagctgcattggcacgacttcagcagc
gacgccgccgaggttcgccagcaacgcctgcaacagctggccgacgaccaggcccaccag
cccttcgacctggaacgcggcccgctgctgcgcgcctgcctggtcaaggccgacgagcgc
gagcactacttcgtgctgaccctgcaccacatcgtcaccgaaggctgggccatggacatc
ttcgcccgcgagctgggcgagctgtacgaggccttcgtcgacgagcgcgagtcgccgctg
gcgccgctgccggtgcagtacctcgactacagcgtctggcagcgccagtggctggagggc
ggcgagggtgcgcgccagctggcctactggaaagaccgcctgggcgacgagcaccccgtg
ctggccttgccggccgaccgcccacgcccggcggtgcagagccaccgtggcgagctgtac
cggttcgacctggcaccggcactggtcgaacgcgtgcacgcgttcaacagccagcgcggc
cttaccctgttcatgaccatgaccgccaccctggctgcgctgctgcaccgctacagcggc
cagcgcgacctgcgcatcggcgcgccagtggccaaccgcatccgcccggaaagcgaaggg
ctgatcggcgccttcctcaacacccaggtgctgcgttgcgaggtggacgggcagatgagc
gtcagcgcgctgctcgaccaggtgcgcactgccatcattgatggccagtcgcaccaggac
ctgccgttcgagcaactggtcgaagcgctgcaaccgccgcgttcgagcgcctacaatccg
ctgttccaggtgatgtgcaacgtgcagcgctgggcgttccagcagagccgtgagctggtg
ggcatgcaggtggactacctggtcaacgacgccagtgccaccaagttcgacctgtacctg
gaagtcaccgacctcgacggccgcctgggctgctgcttcacctacagccgcgacctgttc
gacgagccgcgcatcgcacgcatggccgagcactggcagcacttgctggtagccttgctc
gacgatcctcgccagcgcctgtgcgagctgccgatgctggccgaagccgagcagcaggtg
ctggtcggccagctccagggcgagcaggacttcgagctcacccaaacgctgcacggcctg
ttcgccgcccaggccgagcgcacgccgcaggcgttggcgctgaccttcgccggcacccac
ctgagctacgccgagctcgaccagcaggccaaccgcctggcccgcgccctgcgcgagcgc
ggtgtcggcccgcaggtgcgggtaggcctggcgctggagcgttcgctggagatggtgatc
ggcctgctggcgatcctcaaggccggtggcgcctatgtgccgctcgaccctgaataccca
ctggaccgcctgcgctacatgatcgaagacagccgcatcggcctgctgatcggccagcgt
gcgctgctcgacaccctgggcgagctgcccgacggcgtcgcccgctggagcctggaggac
gatgccgccagcctggccgcctacagcgacgcaccgctggacaacctcaacctgccgcag
caccaggcctacctgatctacacctccggctccaccggcaagcccaagggcgtggtggtc
agccacggcgagatcgccatgcactgccaggcggtcatcgctgagttcggcatgcgcagc
gacgactgcgagctgcacttctattcgatcaacttcgacgccgccagcgagcgcctgctg
acgccgctgctgtgcggtgcccgcgtggtgctgcgggcccagggccagtggggtgccgaa
gagatctgccagctggtgcgcgagcagcaggtgagcatccttggcttcaccccgagctac
ggcagccagttggcccagtacctggccgggcagggcgagcaactgccggtgcgcctggtg
atcaccgggggcgaggcgctgaccggcgagcatctgcaacgcattcgccaggccttcgtg
ccccaacagttcttcaacgcctacggcccgaccgaaaccgtggtcatgccgctggcatgc
ctggcgccggacacgctgcccgccgatgccggcagcgtgccgatcggccgggtgatcggc
gcgcgtaccgcctacatcctcgacgaggacctggccctgctgccgcaaggcggcatcggt
gagttgtatgtaggcggcgcgggtctggcccagggttaccacgaccgcccggggctcagc
gccgagcgcttcgtcgccgacccgttcagccatgacggtggccgcctgtaccgcaccggc
gacctggtgcgcctgcgcgccgatggcctggtggagtacgtcggccgtgccgaccagcag
gtgaagatccgcggcttccgtatcgagctgggcgagatcgaaagccgtctgcaggaacat
gccgatgtcgaggaagccgtggtcctggccctcgacctgccaggtggcaagcaactggtg
ggttacctggtctgcccgcaggccaagggcactgcggatgcccaggccgtgctgcgcgaa
gcggtcaaggccgaggcccgcctgcacctgccggactacatggtgccagcgcacctggta
ctgctcgagcgcctgccgctgatgggcaacggcaagctcgaccgccgcgcgctgccggcc
ccggacctggagcaggcgcgccagcattaccaggccccggccaacgaactggaaacgcag
ctggcgcaggtctggcgcgaagtgctcaacgtctcgcgcatcggtgtgcaggacaatttc
ttcgaactgggcggtgactcgatcctgtcgatccaggtagtcagccgtgcccgtcagctg
ggattgcagttcaccccgcgtgacctgttccagcaccagaccatccagaccctggccgcc
gtggtcactcgcagtgaggcaccgagcgacatcgagcaaggccagcgccaggggcgcact
ggcctgacacccatccagcattggttcttcgacagcgaggtgccgcagccgcagcactgg
aaccaggctgtcctgctgcaggcgctgcagcccctgcgaaccgaggtgctggagcaggca
ttgaacgcgctggtggcgcatcacgatagcctgcgcctgcacttcgagcagcacaatgga
cgttggcagggcagctatggccagccgacggcccagccgctgctgtggacggccacggtg
agcgacctcgacgactgccaggcgctctacaccgatgtgcagcgcagcctcgacctggcc
caggggccgctgctgcgcgcgctgctggtgaccgacgggcagggcgcacaacgcctgttg
ctggcgattcaccacctggtggtcgacggtgtgtcctggcgtgtgctgctggaagacctg
caggcgctgtatcgcggcgaaacccttgcggccaagacccacgccatgggcgactgggcc
gaacgcctggccagctatgccggcagtgactcactgcgcgatgagctgggttggtgggaa
ggccagttgggcagcgcccgccatgaactaccgtgcgatcacccgcaaggcgagagcctg
aatcgccatgcccgcagcgtggccatcgaactggatgtggagcagacccgtcagttgctg
caacaggccccggcggcctatcacacccaggtcaacgacctgttgctgaccgccctggcc
cgcaccctgtgccgctggagtggcgacgagcaggtgctggtgcagctggaaggccacggc
cgtgacggcttgttcgaggacatggacctgacccgcagcgtcggctggttcaccaacgcc
tacccgctgagcctgagccccgccgtgggcgaggacgaggtggctcgcgcggcatcgatc
aagcgcatcaaggagcaactgcgccaggtgccgcacaaagggcagggctatggcgtgctg
cgctacctggccgatgacgccgaccgtgagcgcatggccgcgctgcctcaggcgcgcatc
accttcaactacctcggccagttcgaccagcagttcgacgcggccgcgctgttccagccg
ctcgacgcgccggccgggctggcccatgacctggatgcgccgctgcccaactggctcagc
gtcgatggccaggtgtacggcggcgccctgcaactgcgctggagcttcagcgccgagcgc
tacgacgaggcgaccatcgcccagttggccgaggcgtatcgccaggaactgctggccgtg
gtcgcccactgcctggcggatggcaacggcagcttcacgccgtccgacttcccgctggca
caactgacccaggagcagatcgacacgctgccggtgcctgctaccgagatcgaggatgtc
tacccgctgacgccgatgcaggaaggcctgctgctgcacaccctgctggagccgggcacc
ggcctgtactacatgcaggaccgctaccgcatcaacagcgccctggacccggagcgcttc
gcccaggcctggcaggcggtggtggcgcgccatgaagccctgcgcgcctcgttcagctgg
aatgccggcgaagcgatgctgcagatcatccacaagccgggccacacgccggtggactac
caggattggcgcggtcttgacgaggccacccaggaggcgcgcctgcaagccctgcacaag
caggagcgcgaggccggcttcgagctgctgcgcgaggcgccgttccacctgcgcctggtg
cgggtggatgaggcacgctactggttcatgatgagcaaccaccacatcctcatcgatgcc
tggtgccgttcgctgctgatgaacgacttcttcgagctttaccaggcgctcggcgaaggc
cgccaggcgcaactgccggtgccgccgcgctaccgcgactacattggctggttgcagcgc
caggacctggccgaagcacgccagtggtggcaggacaacctggccggcttcgaacgcgcc
acggcgatccccagcgaccggccgctgcgccatgaccatgccggcgacggcatggtggtc
ggcgactgctacacccgcctcgacgtcgccgagggtgcccgcttgcgtgagctggcccag
gcccaccaactgaccgtcaacaccttcgcccaggcggcctgggccctgaccctggcacgc
tacagcggcgaacgcgacgtggtgtttggcgtcaccgtggccgggcgcccggtaagcctg
ccgcagatgcagcgcacggtcggcctgttcatcaacagcatcgccctgcgcgtgcagttg
ccgcagccgggcgagcgcgccagcgtgcgccagtggctgcaaggcctgctggaccgcaac
atgcaattgcgcgagtacgagtacctgccgctggtggctatccaggagtgcagcgagctg
cccaagggccagccgctgttcgacagcctgttcgtgttcgagaacgccccggtggaaacc
gccgtgctcgaccacgcccagcacctgaacgccagctccgactcgggccgcacccacacc
aacttcccgctgaccgcggtgtgctacccgggcgacgacctgggcctgcacctgtcgttc
gaccagcgttacttcgattacccgaccgtagagcgcctgctggccgagttcaagcgcctg
ctgctggcgctggtcgaaggcttcgatggggaggtgggcgagctgccgctgctgggggcc
gaagagcagcgtttcctgcttgatgattgcaaccgtactgagcatgcctatgagcttgag
cagagctacgtcgaactgttcgaggcgcgggtcgccgcccatccgcaacgcaccgtcgcc
cgctgcctggacgccgcgttcgactatgcagggttgaacctggcagccaaccgcctgggc
cacgccctgatggcggcgggtgtggccgtcgaccagccggtggcgctgctggccgagcgg
ggcctggcattgctggggatgatcgtcggcagcttcaaggctggcgccggttacctgccg
ttggacccgggcctgccgtcggcgcgcctgcaacgcatcgtcgagctgagccgcacaccg
gtactggtgtgcagcgccgcctgcgccgaacaggcgcgtgtgctgctcgatgaagtggcg
ggggccgtgcggcccaagttgctggtgtgggaagaggtgcaggcgagcaacgtcgccagc
cacaacccaggcattcacagcgggccggacaacctcgcctacgtgatctacacctcaggc
tccaccggcttgcccaagggcgtgatggtcgagcagcgcggcatgctcaacaaccagctg
agcaaggtgccgtacctggcgctggacgagcaggacgtgatcgcccagaccgcctcgcag
agcttcgatatctcggtgtggcagttcctcgccgcgccgctgttcggggccagggtagag
atcgtgccgaacgccatcgcccatgatccacagggcttgctggcccatgtgcaggccacc
ggcatcaccgtgctggaaagcgtgccgtcgctgatccagggcatgctggccaacgaccac
caggccctcgacggcctgcgctggatgctgccgaccggcgaggcgatgccgccggagctt
gccgcgcaatggctgcagcgttatccggccatcggcctggtcaacgcctatggcccggcg
gagtgctcggacgacgtggcgttcttccgcgtggacctcgagtcgacccagggcagctac
ctgccgatcggcacgccgaccgacaacaaccgcctttacctgctgggcgaggaccagacc
ctggtgccgctgggtgcggtgggtgagctttgcgttgctggcactggcgtaggccgtggt
tatgtcggcgatccggtacgcacggcgcaggccttcatcccgcatccttatggcgcaccg
ggtgagcgtctgtaccgcaccggcgacctcgctcgccgccgcgcggatggcgtgttggag
tacgtcggccggatcgaccatcaggtgaagatccgcggctaccgcatcgaactgggcgag
atcgaggcgcgcctgcacgagcagcaggagctgcgcgatgcggccgtgggcgtgcaggaa
ggcgccaacggcaagcatctggtcggctacctggtggcgcaccagggcgtcgaggccgat
gccgcgctgctcgaccagttcaagcaacgcctgcgtgccgagctgccggaatacatggtg
ccgctgcactggggctggttcgacagcctgccgcacaacgccaacggcaagctcgaccgc
aaggcgctgccggccatcgacatcggtggccagcacagccaggattacctggcgccgcgc
aacgagctggaggagaccctcgccggcatctgggccgatgtgctcaaggccgagcgggtg
ggggtgcgtgacaacttcttcgagctgggcgggcattcgctgctggccacgcagatcgcc
tcgcgggtgcagaaggcgttgcagttgaacgtacccctgcgggcgatgttcgagtgcagc
acggtggaggagttggctgcgtatgtgcaggggctgcagggcagcgcgctggacgatgac
aaggtcgatcggttgagtgacctgatggcggagctcgaggcgctctga

DBGET integrated database retrieval system