KEGG   Pseudomonas entomophila: PSEEN5476Help
Entry
PSEEN5476         CDS       T00362                                 

Definition
(GenBank) putative aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pen  Pseudomonas entomophila
Pathway
pen00010  Glycolysis / Gluconeogenesis
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01120  Microbial metabolism in diverse environments
pen01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEEN5476
Enzymes [BR:pen01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PSEEN5476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF4394
Motif
Other DBs
NCBI-ProteinID: CAK18087
UniProt: Q1I2P9
LinkDB All DBs
Position
5796017..5796913
Genome map
AA seq 298 aa AA seqDB search
MANFQVDTEQHGELNCWRITSEHAELLIAQQGAQVLSYQRIGEPPLLWLSDQAIFRQGKS
VRAGAPVCWPWFGIFERNPDSVKAMYKGEQPPAHGLVRGRDWQLLGVEEAGDTLRIEFAL
PEAQGDLPGWPHEVELKLVVELGQQLKLTLTSYNLGNTDVTLSQALHSYFAVSDVRQVQV
EGVDGLAYIETLANWEQRQQQGNLGFAGETDRIYLNAPERLAIVDPHWNRRITLQAGGSR
TAVIWNPWTDRARDLPDMADDGWQRMLCIETANVMDDVVTLRPGASHSMSVAIGSEVL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggctaacttccaggtcgacaccgagcaacacggcgaactcaactgctggcgcatcacc
agcgaacacgccgaactgctgatcgcccagcagggcgcgcaggtcctcagctaccagcgg
atcggcgagccgccgctgctgtggctgagcgaccaggccatcttccgccagggcaagtcg
gtgcgcgccggcgcgccggtgtgctggccgtggttcggcatcttcgagcgcaaccccgac
tcggtcaaagccatgtacaagggcgagcaaccaccggcccacggcctggtgcgtggccgc
gactggcagttgctgggcgtcgaggaggccggcgacaccttgcgtatcgagttcgcgcta
cccgaagcccaaggcgatctgccgggctggccgcacgaagtggagctcaagcttgtggtg
gagctgggccagcaactgaagctgaccctcaccagctataacctcggcaacaccgatgtc
accctgagccaggccctgcatagctactttgccgttagcgacgtgcgccaggtgcaggtg
gaaggtgtggatgggctggcctatatcgaaaccctggccaactgggaacagcgccagcag
cagggcaacctgggcttcgcgggcgagaccgaccgcatctacctgaacgcccctgagcgc
ctggccatcgtcgacccgcactggaaccggcgcatcaccctgcaggccggcggctcacgc
actgcggtgatctggaacccctggaccgaccgcgcccgcgacctgccggacatggccgac
gatggctggcagcgcatgctgtgcatcgagacggcgaatgtgatggatgatgtggtgacg
ctgaggccgggggccagtcattcgatgagcgtggcgatcggtagcgaagtactctga

DBGET integrated database retrieval system