KEGG   Petrimonas sp. IBARAKI: PEIBARAKI_2597Help
Entry
PEIBARAKI_2597    CDS       T05132                                 

Definition
(GenBank) Sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
pet  Petrimonas sp. IBARAKI
Pathway
pet00511  Other glycan degradation
pet00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pet00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PEIBARAKI_2597
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PEIBARAKI_2597
Enzymes [BR:pet01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     PEIBARAKI_2597
Bacterial toxins [BR:pet02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   PEIBARAKI_2597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_assoc_N BNR_2 BNR_3 BNR Sortilin-Vps10 CHB_HEX_C End_beta_propel DUF4185 TadE
Motif
Other DBs
NCBI-ProteinID: BBA16470
LinkDB All DBs
Position
complement(3210092..3211750)
Genome map
AA seq 552 aa AA seqDB search
MTYNPILIKKILVFPVFMLLSLGFMQAGDTLRVKQTQVPILIDRIDNALFYISIDAREAV
KLTELKLKFSESSNLNEVESLKLYYGGTEAVQRKGQTFYHPVQYLSGFTPGKTREANPSY
SVKVVEQKSPGIEVAFSANYPLFPGINYFWISLQMKPTTSLLSKIDVNLVSAKLDGRDAP
ISFANNTETHRMGVGVRHAGDDGVAAFRIPGMVTSNRGTLLGVYDVRYNNSVDLQEHVDI
GLSRSTDKGQTWEKMRIPVAFGEYGGLPKAQNGVGDPSILVDRKTGTIWIAALWTHGMGN
YRAWHNSQAGMDEKRTGQLILTKSMDDGKTWSEPINITSQVKDPSWHLLLQGPGRGITMQ
DGTLVFPIQFIDSTRIPNAGIMYSKDSGQTWKIHNHARTNTTEAQVAEVEPGVLMLNMRD
NRGGSRAVSITKDLGKTWTEHPSNRSVLQEPVCMASLIKVDANENVLGKDILLFSNPNTT
EGRHHITIKASLDGGLSFPEEYQVLLDEDPGWGYSCLTVIDKETVGILYESSVAHMTFQA
VKLRDIIKGPRQ
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgacttataatcccattttaataaaaaaaattctggtattccccgtttttatgcttttg
tcgctggggtttatgcaggcaggtgacacccttcgtgtgaaacaaacgcaagttcctata
ttgatagaccgcattgataatgcccttttttatatcagtatcgatgcgagggaggctgta
aaattgaccgaattgaaacttaagttctccgaaagctcaaacctgaacgaggtggagtct
ttaaaactttattatggaggaaccgaagccgttcagcgtaaaggacaaacattttatcat
cctgtacaatacctgtcgggattcacgccgggtaaaacccgcgaggcaaatccttcctat
tcggtgaaggttgttgaacaaaaatcgccagggatcgaagtggccttttcggcaaattac
ccccttttcccggggatcaactatttctggatcagccttcagatgaaacccaccacctcc
ctgttgtcgaaaattgatgtgaatctggtttcagcaaagctcgacggaagagatgctccc
atatcgtttgccaataatacggaaacacaccggatgggagtgggggttcgccatgcagga
gacgatggcgttgccgccttccgtattccaggcatggtcaccagcaatagaggaacgttg
ctgggtgtttacgacgtccggtacaacaacagtgtggatttacaagaacacgttgatata
gggttgagccggagtaccgacaagggccagacctgggagaagatgcgtattccggttgcg
ttcggtgaatatggcggattacccaaggcccagaatggagtgggggacccatccattttg
gtggacaggaagacagggacaatctggattgccgccctgtggacgcacggcatgggaaat
tacagggcatggcacaactcgcaagccggcatggatgaaaaacggacggggcagctgata
ttgacaaaaagcatggatgacggtaagacctggtcggaacccatcaacatcacttctcag
gtaaaagacccttcgtggcatttattgctacagggtcccggaaggggaatcaccatgcag
gacggaacattggttttccccattcagtttattgactctacccggatacccaacgccggc
atcatgtacagcaaggacagcggacagacctggaaaattcataatcacgcccgtacaaac
acaacggaagcgcaagtggcggaagtcgagcccggcgttttgatgcttaatatgcgcgat
aatcgcggaggaagccgtgccgtttccataacgaaggatttaggcaaaacttggacggag
cacccgtcaaacagaagcgtcttgcaggaaccggtttgcatggcaagcctgataaaagtg
gatgccaatgaaaatgtactgggtaaggatatattgctgttctccaatcccaacaccacc
gaaggaagacatcacattaccatcaaagccagcctggacggaggattatcgtttcccgaa
gaataccaggtgctgttggatgaagatcccggttggggctactcttgcctgactgtgatt
gataaagaaaccgttggaatcctttacgaaagcagcgtggcacacatgactttccaggca
gtgaagctaagggatattattaaaggtcccaggcaatag

DBGET integrated database retrieval system