KEGG   Planococcus faecalis: AJGP001_08870Help
Entry
AJGP001_08870     CDS       T04955                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pfae  Planococcus faecalis
Pathway
pfae00010  Glycolysis / Gluconeogenesis
pfae00053  Ascorbate and aldarate metabolism
pfae00071  Fatty acid degradation
pfae00280  Valine, leucine and isoleucine degradation
pfae00310  Lysine degradation
pfae00330  Arginine and proline metabolism
pfae00340  Histidine metabolism
pfae00380  Tryptophan metabolism
pfae00410  beta-Alanine metabolism
pfae00561  Glycerolipid metabolism
pfae00620  Pyruvate metabolism
pfae00625  Chloroalkane and chloroalkene degradation
pfae01100  Metabolic pathways
pfae01110  Biosynthesis of secondary metabolites
pfae01120  Microbial metabolism in diverse environments
pfae01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AJGP001_08870
   00053 Ascorbate and aldarate metabolism
    AJGP001_08870
   00620 Pyruvate metabolism
    AJGP001_08870
  Lipid metabolism
   00071 Fatty acid degradation
    AJGP001_08870
   00561 Glycerolipid metabolism
    AJGP001_08870
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AJGP001_08870
   00310 Lysine degradation
    AJGP001_08870
   00330 Arginine and proline metabolism
    AJGP001_08870
   00340 Histidine metabolism
    AJGP001_08870
   00380 Tryptophan metabolism
    AJGP001_08870
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AJGP001_08870
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AJGP001_08870
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AJGP001_08870
Enzymes [BR:pfae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AJGP001_08870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AQU79366
LinkDB All DBs
Position
complement(1774574..1776046)
Genome map
AA seq 490 aa AA seqDB search
MKTDFSKIYINGEWIQGSSNNQMKNTNPFTGEELVITQAADKSDLDLAYKAAAEAQVEWA
KELPQNKRAVIEKAIEVMQENKELIIDWLVKEAGSTVIKATVEFGASVNILKEAATFPYR
MEGKILPSQQAGKENRVYRNALGVIGIISPWNFPFHLAIRSIAPAIATGNAVVIKPATDT
PVTGGLLFASIFEAAGLPKGLLNVVVGRGSEIGDDIVTHPTPRLISFTGSTPVGKRIGEL
AGGALKKTALELGGNNNFIVLKDADVDQAVDSALFGKFYHQGQICMSINRIFVHQDIYDD
FAEQFITRASKLKFGNPAEQDTQVGPLINRDQVDRILKDINASVEQGAQIRLGGQADGNV
LEPTVLTGVTNDMPLAENEIFGPVAILIPFDSDEEVVKMANAYPYGLSGAVHSSNIEYGT
TIAHQIHTGMIHVNDQSVNDEAHMPFGGEKDSGLGRFNGEWVLEEFTTLKWLSVQHQRRE
YGPFVTNTKK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaccgatttttcaaaaatttatataaatggtgaatggattcaaggttctagtaat
aaccagatgaaaaataccaatccatttactggtgaagaactagtaatcacacaagctgcc
gataaaagtgatttagatttggcttataaagctgctgcagaagcacaagttgaatgggca
aaagaactaccgcaaaacaaacgagcggttattgaaaaagcaatagaagtcatgcaggag
aacaaagagctaattattgactggttagttaaagaagcaggcagtactgtgattaaagca
acagttgagtttggtgcgtcagttaacatcttgaaagaagcagcaactttcccttaccgg
atggaaggtaaaattcttccttcgcaacaagcaggtaaagaaaaccgtgtataccgcaat
gcactaggagttatcggtattattagcccgtggaatttcccattccatttagcgattcgt
tctatcgcgcctgctattgcaactggcaatgcggttgtgatcaaacctgcaaccgataca
cccgtaacaggtggattgttgtttgccagcattttcgaagcagctggattgcccaaaggt
ctattaaacgtcgtagttggacgtggttcagaaatcggtgatgacattgtaacgcatcca
acaccgcgtttgatttcctttactgggtctacgccagtcggaaagcgtattggtgagctc
gcgggtggcgcgttaaagaaaactgcgttagaacttggtggaaacaataattttatcgtc
ttaaaagatgctgatgtagatcaggctgtcgattccgcattattcggtaaattctatcac
caaggtcaaatttgtatgtctatcaaccgcatttttgttcatcaagatatttatgacgat
ttcgcagagcagttcattacacgtgctagcaaattaaaattcggaaatcctgccgaacaa
gatacgcaagtcggaccgctgattaaccgcgatcaagtcgaccggattctcaaagacatc
aatgcaagtgtggagcaaggtgcccaaattcgtcttggaggacaagcggatggcaatgtg
ctagaaccaactgttctaactggcgttacaaatgatatgcctcttgcagaaaatgaaatt
tttggtcctgtagcaattctgattccttttgatagcgacgaggaagtcgtgaagatggca
aatgcttatccgtatggattgagcggagctgtccattcctcaaatatcgaatacggaacg
accatcgctcatcaaatccacacgggcatgattcatgtaaacgatcaatcggttaacgat
gaagcgcatatgccgtttggtggagaaaaagattcaggtctaggccgtttcaatggtgaa
tgggtactagaagagtttacaacgttaaaatggctatcggttcaacatcaacgtcgtgaa
tatggaccatttgttactaacaccaaaaaataa

DBGET integrated database retrieval system