KEGG   Pseudomonas fluorescens LBUM223: VO64_2945Help
Entry
VO64_2945         CDS       T03769                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pfb  Pseudomonas fluorescens LBUM223
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VO64_2945
Enzymes [BR:pfb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     VO64_2945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3275837..3276736
Genome map
AA seq 299 aa AA seqDB search
MPTPHVETVKVDELDCWRIRHNGAELMVARQGAHIFSYQREGEQPLIWPNPKAVFKQGKG
IRTGVPVCWPWFGVFDRNPQSVKAMRQSDQPAGSHGFARTALWELAETAIEGEALRIELA
LPVPPNGFPGWPHQVDLTLSLLLDDQLHIRLTSHNRGTDTVTLSQALHTYFAVSDVRNVQ
VEGLDGLAYIDTADGWTEKRQAGLLHFTAETDRIYLDTPAQLSIVDKDWQRRVKLTSQGS
NSTVVWNPWTERAKALDDMADDGWQGMLCIETANVLDDVVSLAAGESHTLGVSITSITL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcctacgccccacgttgaaacggtgaaagtcgacgagctggactgctggcgcattcgc
cacaacggcgccgaactgatggtggcccggcagggcgcgcacatcttcagttaccagcgc
gagggcgagcagccgctgatctggcccaaccccaaggcggtattcaagcagggcaaaggc
attcgtaccggcgtgccggtgtgctggccgtggtttggtgtattcgaccgtaacccgcaa
agcgtcaaggcgatgcgtcaaagcgatcaaccggctggctcacatggctttgcgcgcacc
gccctctgggaattggccgagactgcaatcgaaggtgaagccctgcgtatcgaactggcg
ctgccggttcctccgaacggctttcccggctggcctcaccaggttgacttgacgctgagc
ctgctgctggacgaccaattgcatattcgcctcaccagccacaaccgtggcaccgacacc
gtgaccctcagccaggcgctgcacacctactttgctgtgagcgatgtgcgcaacgtgcag
gtcgagggcctggatggcttagcatacatcgataccgccgacggctggaccgagaagcga
caagccggcctgctgcacttcaccgccgagacggatcgcatctacctggacacgccggcg
cagttgagcattgtcgataaggactggcagcgccgcgtcaaactcaccagccagggctcg
aactcgacggtagtctggaacccctggaccgaacgagccaaggcgctcgatgacatggct
gacgatggctggcagggcatgttgtgcatcgagacggcgaatgtgctggatgatgtggtg
agcctggcggccggtgaaagccacaccttgggcgtgagcatcaccagtatcaccttgtaa

DBGET integrated database retrieval system