KEGG   Pseudomonas fluorescens LBUM223: VO64_5149Help
Entry
VO64_5149         CDS       T03769                                 

Definition
(GenBank) Pyoverdine chromophore precursor synthetase PvdL
Organism
pfb  Pseudomonas fluorescens LBUM223
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5729731..5742627
Genome map
AA seq 4298 aa AA seqDB search
MMDAFELPRTLVQSLQRRAAQTPDQVALRFLAESTEHSEVLSYRDLDLRARTIAAALQAN
AGPGERAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESTRRHHQERLLSIIQDAEPRLL
LTIASLSEGLAQIENAPPVLSVDSLDAQQAEHWLEPELQADDIAFLQYTSGSTALPKGVQ
VSHGNLVANEVLIRRGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLMSPAY
FLGRPSRWLEAISEYGGTISGGPDFAYRLCSERVSESALERLDLSRWRVAYSGSEPIRLD
TLERFAEKFAPCGFTSNSFFASYGLAEATLFVAGGIRGRGIPAMHMDEQALAANRAEPGQ
GSAIMSCGTSQPDHAVLIADPHSLMELADNSIGELWATGPSIAHGYWRNPEASARTFVQH
AGRTWLRTGDLGFIRDGEVYITGRLKDLLIVRGHNLYPQDIEQTIEREVEVVRKGRVAAF
AVNDLGVEGIGIAAEISRSVQKILPPEALIKAIRQAVAEAYQEAPSVVVLLNPGALPKTS
SGKVQRSACAIRHADGSLDSYAQFPGLPTQASEVALESDLHNQIAAIWCEQLQLTSVAAD
DHFFLLGGNSITATQVVARLRETLGLELNLRLLFEAPTLSAFAAGVAQLQQDRGVAQGAI
HALSRHEDLPQSLAQNRLWITWQLDPHSSAYTIPGALHLRGELDEDALRSSFQHLIQRHE
ALRTRFYERDGQAFQRVEPQVDFALQVIDLSDLPHAEREARAQQIREDEAHTQFDLEKGP
LLWVTLLRLDDEDHQLLVTLHHIIADGWSLNILIDEFSRLYAAAVQGQSLELPPLSLHYA
DYGSWQRQWLAEGEGQRQLAYWKTQLGEEHPALDLATDHPRSALHRHSASRHSVRLDARL
SAAIRQTAQAHESTPFMLLLAAFQTLLYRYSGQRDIRIGVPSANRPRHETQGLIGFFINT
LVLRAELDGRLPFNQLLAITRETAMAAQAHQDLPFEQLLEAFPQAREQGLFQVMFNHQQR
DLSALRRLPGLLADELPWHSREAKFDLQLHSEEDRNGRLSLSFDYADELFETATIQRMAE
HFIHLLQAVCAQPQQALGDLPLMLADEQHAWSAAPCEPARQWLPDLLNQQVSDATALVWQ
DGSLTFAQLHTQANRLAHYLRDKGVGPDVCVAIAAERSPQLLVGLLAIIKAGGAYVPLDP
DYPAERLAYMLKDSGVHLLLTQTALLAQLPTAEGVCVIAMDSLHLDSWPTQAPGLHLHGD
NLAYVIYTSGSTGQPKGVGNTHGALAERLQWMQATYQLNETDVLMQKAPISFDVSVWECF
WPLITGCRLVLAGPGEHRDPQRIAQLVQEHGVTTLHFVPPLLQVFIDEPLVAECTSLRRL
FSGGEALPAELRNRVLAQLPAVQLHNRYGPTETAINVTHWHCTAADGERSPIGRPLGNVI
CRVLDEQLNPLPAGVPGELCIGGIGLARGYLGRAGLTAERFIADPLGAAGTRLYRTGDRA
RWNADGVLEYLGRLDQQFKLRGFRVEPEEIQARLLALDGIAQAVVLVRDAQLIGYYTAHS
ALDEQQVRTTLAAELPEYMVPALLMRLDAMPLSPSGKLDRRALPEPVWQTREHIEPHTAL
QLQIAAIWREVLGLPRIGLGDDFFALGGHSLLATQIISRTRQACDVELPLRTLFEASELG
AFVEQVGLIQAAGQRNQQTAIAKVDRSQPVPLSYSQQRMWFLWQMEPDSPAYNVGGMARL
RGVLDVQRFEAALQALIMRHETLRTTFPSVDGVAYQKVSPQTAVRMDWQDFSALSETERQ
QRLQQLADQEAHTPFNLETGPLLRACLVKAGEQEHYLVLTLHHIVTEGWAMDIFARELSA
LYEAFIDERDSPLAPLPVQYLDYSVWQRQWLESGERQRQLDYWTAQLGTEHPLLELPGDR
PRPAVQSHQGELYRFDLSDELAARVRAFNAERGLTLFMTMTATLAVLLYRYSGQTDLRIG
APVANRIRPESEGLIGAFLNTQVLRCQLNGQMSVAQLFEQVRHTVIEGQSHQDLPFDHLV
EALQPPRSAAYNPLFQVMCNVQRWEFQQRRQLAGMTVEYLANDARATKFDLNLEVTDLDH
RLGCCLTYSTDLFDEPRIARMAEHWRNLLEGLIANPQQRLSELPLLSADEQRALQDSLGV
EKGEHRLDQCIHQLFSQQASQRADAPALTFAGVTLTYAELDARANRLAWMLRERGVGPQV
RVGLALPRSLEMVIGLLAILKAGGAYVPLDPEYPLDRLHYMIEDSGIGLLLSDAAMFEAL
GELPATVACWCLEDDLPVLANYPADTLPFVSLPQHQAYLIYTSGSTGKPKGVVVSHGEIA
MHCQAVIERFGMRADDCELHFYSINFDAATERLLVPLLSGAQVVLRAQGQWDAEEICTLI
RTHRINILGFTPSYGSQLAQWLATQQQTLPVRMCITGGEALTGEHLQRIRAAFMPEVFFN
AYGPTETVVMPLASLAPQQLEEGAGSVPIGSIIGARVAYILDADLALVPQGASGELYIGG
AGLAQGYHRRPGMTAERFVADPFAANGGRLYRTGDLVRQRADGLVEYLGRIDHQVKIRGF
RIELGEIETRLLEHPDVREAVVLALDAPSGKQLVAYLVSDAEHGALREALKAHLKAQLPD
YMVPAHLIVLDSMPLTANGKLDRRALPEPDPQANRQHYVAPRNALESTLAAIWCAVLNVQ
QVGLDDNFFELGGDSILSIQVVSRARQAGIHFSPRDLFQHQTVETLAAVATRSEQVTAEQ
GVLTGSSGLTPIQHWFFDTDIPARQHWNQALVLKPLQLLDPHRLEQALLAVLEHHDALRL
SFTRRDAQWHAEHLAVPEGGVLMQAQVGDMQQCTALFTDTQRSLDLEHGPLLRALLVDGP
QGQQRLLIAIHHLVVDGVSWRVLLEDLQNVYRQLSEGQSVSLPAKTSALRDWAARLQAYA
HSESLREELSVWQAQLAGPAVALPVQRPQGARRNRDAETVSVRLDAEHTRQLLQQAPSAY
RTQVNDLLLTALARVLCRWSGHDSALVQLEGHGRETLFDDIDLTRSVGWFTSAYPLRLTP
QAGQGDSIKAIKEQLRALPHKGLGYGVLRYLADDLCKQSMAALPSAPITFNYLGQFDQSF
GSDALFHPLEESAGLAHDPDAPLPNELSVDGQVYGGELVLRWTFSRERHDQQVIRDLAEA
YLAELHSLIAHCLQDDAGGLTPSDFPLARLTQAQLDALPVPACAIEDVYPLTPMQEGLLL
HTLLEPGTGLYYMQDRYRINSALDPERFAQAWQAVIARHEALRASFCWNVGEDMLQVIHK
PGSTPIEYLDWSADPEAEQEPRLQALLKAEREAGFDLLNQAPFHLRLIRVGESRYWFMMS
NHHILIDAWCRSLLMNDFFDIYMALGEGRDAQLATPPRYRDYIAWLQRQDLDEARQWWQR
NLQGFERTTPIPSDRPFLREHAGGSGGMVVGDCYTRLDACDGAQLRELAQAHQLTVNTFA
QAAWALVLRRLSGERDVLFGVTVAGRPVDMPQMQRTVGLFINSIALRVKLPEDDQRCSVR
QWLSGLLDSNMQLREYEYLPLVTIQEHSELPKGQPLFDSLFVFENAPVEVSVLDRAQSLN
ATSDSGRTHTNFPLTAVCYPGDDLGLHLSYDQRYFDESTVQGMLGEFKRLLLALVQGFHG
DMAELALIGEQEREFLVDGCNQSERSYPLERSYVELFEEQVAQHPQRIAASCLDQQWSYD
ELNRRSNGLGHALIAAGVGLDQPVALLAERNLDLLGMIIGSFKAGAGYLPLDPGLPSQRL
SRIIDLSRTPLLVCTEACREQAIELLEGVDCQLLVWEEVPARGENPGVYSGPDNLAYVIY
TSGSTGLPKGVMVEQRGMLNNQLSKVPYLDLTDADVIAQTASQSFDISVWQFLAAPLFGA
RVDIVPNTLAHDPQGLLEHVQAHGITVLESVPSLIQGMLAQEHISLDGLRWMLPTGEAMP
PELAHQWLLRYPQIGLVNAYGPAECSDDVAFFRVDLASTRGTYLPIGTPTDNNRLYLLDG
ALELVPQGAVGELCVAGTGVGRGYVSDPLRTAQVFVPNPFGAPGERLYRTGDLARRRSDG
VLEYVGRIDHQVKIRGYRIELGEIEARLHEQPEVRDAAVGVQEGVNGKHLVGYLVAADQT
LKAGERLDRIKQRLRAELPEYMVPLHWLWLERLPLNANGKLDRKALPALEIGQLHSQDYL
APRNELETTLAGIWAEVLKVERVGVQDNFFELGGHSLLATQIASRVQKTLQRDVPLRAMF
ECSTVAELAEYIDGLAANEISAEKVDRLSDLMAELEGL
NT seq 12897 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgccttcgaactcccccgcactttggtccagtcccttcaacgccgagctgcg
cagacaccggaccaggtggctctgcgcttcctggccgagtcgaccgagcacagcgaggtg
ctcagctaccgtgatctggacctgcgcgcccgcaccatcgccgccgccttgcaagccaat
gccggcccgggcgagcgtgcggtgctgctgttccccagcggcccggactacgtcgcggcg
ttttttggttgcctgtacgccggcgtgatcgcggtgccggcttatccgccggagtccacg
cgccgtcatcaccaggagcgtttgctgtcgatcatccaggacgccgagccacgcctgcta
ttgaccattgccagtctcagcgaaggcctggcccagatcgaaaatgcaccgccggtattg
agcgtggacagcctggatgcacagcaggcagagcactggctcgagcccgagctgcaagct
gacgacatagccttcctgcaatacacctccggctctaccgccttgcccaagggtgtgcag
gtcagccacggcaacctggtcgccaacgaagtattaattcgacgtggtttcggcatcgac
ctcaaccctgatgacgtgatcgtcagctggctgccgctctaccacgacatgggcctgatc
ggcggcctgctgcaacccattttcagtggcgtgccctgcgtgttgatgtcgccggcctac
ttcctcgggcgcccatcgcgttggctggaagcgatcagcgaatacggcggcaccatcagc
ggcggcccggatttcgcctaccgcctgtgcagcgaacgggtcagtgaatcggccctggag
cgcctggacttgagccgctggcgcgtggcctattccggctctgagccgattcgcctcgat
accctggaacgcttcgcagaaaaattcgccccttgcggtttcacctcgaacagtttcttt
gcctcctacggcctggccgaagcgaccctgtttgttgccggcggcatccgtggccgcggc
atccccgcgatgcacatggacgaacaggccctggccgccaaccgcgcggaacccgggcag
ggcagtgcgatcatgagttgtggcaccagccagccggaccacgccgtgctgatcgccgat
ccccacagcctcatggagcttgccgacaacagcatcggtgaactctgggccacgggcccg
agcatcgcccacggttactggcgcaacccagaagccagcgccaggaccttcgtccagcac
gctggtcgcacttggttgcgtacgggtgacctgggttttatccgcgacggcgaggtgtac
atcactggtcgcctcaaagacctgctgattgtgcgtggtcacaacctctacccccaggac
atcgaacagaccatcgagcgcgaggtggaagtggtgcgcaagggccgggtcgccgccttt
gcggtgaatgacctgggtgtggaaggcatcggtatcgcggcggaaatcagccgcagcgtg
cagaaaatcctgccacccgaagcgctgatcaaggcgatccgccaagctgtggccgaggct
tatcaagaagccccgagcgtagtggtgttgctcaaccccggtgccttgccgaagacctcc
agcggcaaggtgcagcgctcggcgtgcgcgattcgccacgccgatggcagcctcgacagc
tacgcgcaattccccggcttgccaacgcaggcgagcgaggtggcgctggagtctgacctg
cacaaccagatcgcggcgatctggtgtgagcaactgcaactgaccagcgtggccgccgac
gatcacttcttcctgcttggcggcaactccatcaccgccacccaggtggtcgcccgcctg
cgcgaaaccctgggcctggagctgaacctgcgtctgctgttcgaagcccccacgttgtca
gcgtttgccgccggcgtggcgcaactgcaacaggaccgcggcgttgcccagggcgcgatc
catgcgctgtcgcgccacgaagacctgccccaatccctggcccagaaccgtctgtggatc
acctggcaactggacccacacagcagcgcctacaccattcccggcgccttgcacctgcgc
ggcgagctggatgaagacgcgctgcgctcaagcttccagcacctgatccagcgtcacgag
gccctgcgcacacgcttttacgaacgcgatgggcaagccttccagcgtgtagagccgcag
gtggatttcgcgctgcaagtcatcgacctcagcgacctgccgcacgccgagcgcgaagct
cgtgcgcaacagatccgcgaagacgaggcgcatacccagtttgacctggaaaaaggcccg
ctgctgtgggtcaccctgctacgcctggatgatgaagaccatcaactgctggtgacgctg
caccacatcatcgctgatggttggtcgctgaatatcctcatcgacgaattctcacggctg
tacgccgctgccgtccaaggccagagcctggagctgccgccgttgagcttgcactacgcc
gactacggcagttggcagcgccaatggttggccgaaggcgagggccagcgacaactggcg
tattggaaaacgcagttaggtgaagagcatcctgccttggacctggccaccgatcacccg
cgttccgcgctccatcggcacagtgcttcgcgccatagcgtgcgcctggatgcgcgcctc
agcgccgcgattcgccagaccgcccaggcccacgagtcgacgccgttcatgctgttgttg
gcggcgttccagaccctgctttatcgctacagcgggcagcgcgatatccgcatcggcgtg
cccagtgccaaccgcccgcgccatgaaacccagggcctgatcgggttctttatcaacacc
ctggtgctgcgtgccgaactggatgggcgcctgccgttcaaccagctgttggcgatcacg
cgcgagacggcaatggccgcccaggcccaccaggacctgcctttcgaacaactgctggaa
gccttcccccaggcccgcgaacagggcctgttccaggtgatgttcaaccaccagcaacgt
gacctcagcgccttgcgtcgcctgccgggcctgctcgccgatgaactgccatggcacagc
cgcgaagccaagttcgacctgcaattgcacagcgaagaagaccgcaacgggcgcttgagc
ctgtcgtttgactacgccgacgagctgttcgagaccgcgaccatccagcgcatggccgag
catttcatccacctgctgcaagctgtgtgcgcgcaaccccagcaagccctcggcgacctg
ccgttgatgctggccgacgaacagcacgcctggagcgcagcaccttgtgaaccggcccgg
caatggctgcccgacctgctcaatcaacaggtctcggacgccaccgcgctggtctggcag
gacggcagcctgaccttcgcccaactgcacacccaggccaatcgcctggcccattacttg
cgcgacaagggcgtcggcccggacgtgtgcgtggccatcgccgccgagcgttcgccgcaa
ttgctggtcggcctgctggcgatcatcaaggccggtggcgcctacgtgccgctcgacccg
gattaccccgccgagcgcctggcctacatgctcaaggacagcggcgtgcacctgctgctg
acccaaacggcgttgctggcgcagttgccgactgccgaaggcgtatgcgtgatcgccatg
gacagcctgcacctcgacagctggccaacccaggcaccgggcctgcacctgcatggcgac
aaccttgcctacgtgatctatacctccggctccaccggccaacccaagggcgtgggcaac
acccatggcgcgctggccgaacgtttgcagtggatgcaggccacttaccaactgaatgaa
accgacgtgctgatgcaaaaggcgccgatcagtttcgacgtgtcagtgtgggagtgcttc
tggccgctgatcaccggttgccgcctggtgctggcggggccgggtgagcaccgcgacccg
cagcgcatcgcgcagttggtgcaggaacatggcgtgaccacgctgcacttcgtgccgccg
ctgttgcaggtgtttatcgacgagccgttggtggccgaatgtaccagcctgcgccgcctg
ttctccggtggcgaagccttgcccgccgagttgcgtaatcgcgtcctggcccagctgccc
gcggtgcaattgcataaccgttatggccccaccgagacggcgatcaacgtcacccattgg
cattgcaccgccgccgatggcgagcgctcgccgattggtcggcccttgggcaatgtgatc
tgccgcgtgctcgacgagcagctcaacccgttgccggccggtgtgccgggcgagttgtgc
atcggcggcatcggcctggcccgcggttaccttggccgtgccggcttgaccgctgaacgc
tttatcgcggaccccttgggcgcggcgggcacacgcctgtatcgcaccggtgaccgtgcg
cgctggaatgccgatggcgtacttgaatacctcgggcgtctggatcagcagttcaaactg
cgtggtttccgtgtggagccagaagaaattcaagcgcggctgctggccctcgatggcatc
gcccaagccgtggtgctggtacgcgatgcgcagttgattggttactacactgcccacagc
gcactggacgaacagcaagtcaggaccaccctggccgccgagttgccggaatacatggtg
ccggcgctgctgatgcgcctggatgccatgcccctgagcccgagcggcaagcttgatcgc
cgcgccttgccggagcctgtctggcaaacccgcgaacacatcgaaccgcacacagcgttg
cagctgcaaatcgccgcgatttggcgcgaggtcctcggcctgccacgcatcggcctgggc
gatgacttcttcgctttgggcgggcactcgttgctggccacgcaaatcatctcgcgcacc
cgccaggcgtgtgacgtcgagctgccgttgcgcaccttgttcgaagccagcgagttgggc
gcctttgtcgagcaggtagggctgatccaggccgcgggccaacgcaaccaacaaacggca
atcgccaaggtcgaccgcagccaaccggtgccgctgtcctattcccagcagcgcatgtgg
ttcctctggcagatggagcccgacagcccggcctacaacgtcggcggcatggcgcgcctg
cgcggcgtgctggatgtgcaacgttttgaggcggcgttgcaggcgttgatcatgcgccac
gaaaccctgcgcaccaccttcccgagcgtcgacggcgtggcataccagaaggtttcgccg
cagaccgctgtgcgcatggactggcaggacttctcggcgctgagcgaaaccgagcgccaa
cagcgtttgcaacaactggcggatcaagaagcgcacacgccgttcaacctggaaaccggg
ccgctgttgcgggcctgcctggtcaaggccggcgagcaggaacactacctggtgctgacc
ttgcaccatatcgtcaccgaaggctgggccatggacatctttgcccgtgaactcagcgcc
ttgtacgaagcttttatcgacgaacgcgactcgccgctggcgccgctgccggtgcagtac
ctcgactacagcgtgtggcagcgccagtggctggagtccggcgagcgccaacgccagctg
gattactggaccgcgcaactgggcactgaacacccgttgctggagctgcccggcgaccgc
ccaaggccagcggtacaaagccaccagggcgagctgtaccgcttcgacctgagtgatgag
ttggccgcccgtgtgcgcgccttcaatgccgagcgcggcctgaccctgttcatgaccatg
accgcgaccctggccgtgttgctttaccgctacagcggccagaccgacctgcgcatcggc
gccccggtggccaaccgcattcgcccggaaagcgaagggctgatcggcgcgttcctcaat
acccaggtgctgcgttgccagctcaatgggcagatgagtgtcgcccagctgttcgagcaa
gtccgtcatacggtgatcgagggccagtcccatcaggacctgccgttcgaccatctggtc
gaagccctgcaaccgccgcgcagcgcggcgtacaacccgttgttccaggtgatgtgcaac
gtgcagcgctgggagttccagcagcgccgccaactggcgggcatgaccgtcgagtacctg
gccaacgatgcacgggcgactaagttcgacctcaacctggaagtcaccgaccttgatcat
cgcctgggctgctgcctgacctacagcaccgacctgttcgacgagccgcgcattgcgcgc
atggccgagcattggcgcaaccttttggaaggcttgatcgccaatccgcaacagcgcctc
agcgaattgccgttgctgagcgcagatgaacagcgtgcgctgcaagacagcctcggggtt
gaaaagggcgagcatcgcctcgaccagtgcatccatcagttgttcagccagcaggccagc
cagcgagccgatgccccagcgctgacctttgccggggtgaccctgacttacgctgagctg
gacgcccgcgccaaccgcctggcctggatgctgcgcgaacgtggtgtgggcccgcaggtg
cgtgtcggcctggcgctgccgcgctcgctggaaatggtcattggcctgctggcgatcctc
aaggccggtggcgcctacgtgccactggacccggaatacccgctggaccgcctgcactac
atgatcgaggacagcggcatcggcctgctgctcagtgatgcggcgatgttcgaagccctc
ggcgaattgccggcgacggtggcgtgctggtgcctggaagatgacctgccggtgctggcg
aattacccggccgacacgctgccctttgtcagcctgccacaacaccaggcgtacctgatc
tacacctcgggctccaccggcaagcccaaaggcgtggtggtgtcccacggtgaaatcgcc
atgcattgccaggcggtgatcgagcggtttggcatgcgtgccgatgattgcgagctgcac
ttctattcgatcaacttcgatgccgccaccgagcgtttgctggtgccgctgctcagtggt
gcgcaggtggtgctgcgcgcccaggggcagtgggatgccgaagagatctgcacactgatt
cgcacccatcgcatcaatatcctcggtttcacccccagctacggcagccagttggcccag
tggctggcgacccagcagcagaccttgccggtgcgcatgtgtatcaccggtggcgaggca
ttgaccggggagcacctgcagcgcatccgggcggcgttcatgcccgaggtgtttttcaac
gcttatggcccgaccgaaacggtggtgatgcccttggccagcctggcgccgcagcagttg
gaggagggcgccggcagcgtgccgattggcagcatcatcggtgcgcgcgtggcctacatt
ctcgacgccgacctggcgctggtgccccaaggcgccagcggtgagttgtatatcggcggc
gccggcctggcccagggttatcaccgccgcccgggcatgacggcggagcgttttgtcgcc
gacccgtttgccgccaatggcgggcgtctttaccgcaccggcgacctggtgcgccaacgc
gccgatggcctggtggaatacctggggcgcatcgaccatcaggtgaagatccgcggtttc
cgcatcgagctgggcgagatcgaaacgcgcctgctggaacatcccgacgtgcgcgaggcg
gtggtgttggcgctggatgcgccgagtggcaaacagctggtggcctacctggtcagcgac
gccgaacacggcgcgctgcgcgaagcgctgaaggcgcacctcaaggcgcaactgccggac
tatatggtgccagcgcatttgatcgtgctggacagcatgccgctgaccgccaacggcaag
ctcgaccgccgcgccttgcctgagccggatccgcaggccaatcgtcaacactacgtggca
ccacgcaacgcgcttgaaagcaccctggcggcgatctggtgcgcggtgttgaacgtgcag
caagtcggcctcgacgataatttctttgagttgggcggcgactcgatcctgtcgatccaa
gtggtcagccgtgcacgccaggccgggattcatttcagcccccgcgatctgttccagcac
cagaccgtagagaccctggccgccgtcgccactcgttcggagcaggtcaccgccgagcaa
ggtgtattgaccggcagctcggggctcacgccgatccagcactggttcttcgacactgac
atcccggcacgccagcactggaaccaggcgttggtgctcaagcccctgcaactgctcgac
ccccatcgcctggagcaagccctgctggcggtgctggaacaccacgatgccctgcgcctg
agcttcacccggcgcgacgcgcagtggcacgccgaacacctggccgtgccggaaggcggc
gtgctgatgcaggcccaggtgggtgatatgcaacagtgcaccgcactgttcaccgacacc
cagcgtagcctcgatctggaacacgggccgttgttgcgtgccctgctggtggacgggccg
caaggccagcaacgcttgctgatcgcgatccatcacctggtggtggatggcgtgtcctgg
cgtgtgttgctggaagacctgcaaaacgtctaccgccaactcagtgaaggccaatccgtc
agcctgccggccaagaccagcgcgttgcgcgattgggcggcgcgcttgcaggcctatgcc
catagcgaatccctgcgcgaagagttgagcgtctggcaggcgcagttggccggcccggcc
gtggccttgccggtgcagcgcccacaaggtgcacggcgtaatcgcgatgccgagaccgtc
agcgtgcgcctggacgccgaacacacccgccagttgctgcaacaggcgccgagcgcctat
cgcacccaggtcaacgatctgctgctgaccgccctggcccgcgtgctgtgccgctggagc
gggcacgattcggcattggtccaactggaaggtcatggccgcgaaaccctgttcgatgac
attgacctgacccgcagcgtcggctggtttaccagtgcctatccgctgcgcctgacaccg
caggccgggcagggcgactcgatcaaggcgatcaaggaacaactgcgcgccctgccgcac
aaaggcttgggttatggggtgctgcgctacctggccgatgacctgtgcaaacagagcatg
gccgcactgccgagcgcgccgattaccttcaactatcttggccagttcgaccagagcttt
ggctccgacgcactgttccatccgctggaggagtccgccggcctggcccatgatcctgat
gcgccgttgcccaatgagttgagcgtcgacggccaggtgtatggcggtgagctggtgctg
cgatggaccttcagccgtgagcgtcatgatcaacaggtgattcgcgatctggccgaggct
tacctggccgaattgcacagcttgatcgcccattgcctgcaggatgatgccggcggcctc
acgccgtcggacttccccctggcccgtctgacgcaggcgcaactggatgccttgccggtg
ccggcctgcgccatcgaagacgtctacccgctgaccccgatgcaagagggcctgctgctg
cacacccttctggaaccgggcactggtctgtattacatgcaggaccgctaccgcatcaac
agcgccctggaccccgagcgtttcgcccaggcctggcaagcggtgatcgcccggcatgaa
gccttgcgcgcgtcgttctgctggaacgtcggcgaagacatgctgcaagtgatccacaaa
cccggcagcacgccgattgagtacctggactggagcgccgaccccgaagccgagcaggag
ccgcgcctgcaagccttgctcaaggccgaacgcgaagccggtttcgacctgctcaaccag
gcgcctttccacctgcgcctgatccgtgtgggcgagtcgcgctactggttcatgatgagc
aaccaccacatcctgatcgatgcctggtgccgttcgctgctgatgaatgacttcttcgat
atctacatggccctgggcgagggccgcgacgcgcaactggcgacgccgccgcgctaccgc
gactacattgcctggctgcaacgccaggacctggatgaggcgcgccaatggtggcagcgc
aacctgcaaggtttcgagcgcaccacaccgatcccgagcgaccgcccgttcctgcgcgaa
catgccggtggcagcggcggcatggtggtgggtgattgctacacccgtcttgatgcctgt
gacggtgcgcaattgcgtgaattggcccaggcccaccagctcaccgtcaacaccttcgcc
caggcggcctgggccttggtgctgcggcgtttgagcggcgagcgtgacgtgctgttcggc
gtcaccgtggccgggcgcccggtagacatgccgcagatgcaacgcaccgtcggcctgttt
atcaacagcatcgcgttgcgggtgaagctgcctgaggatgaccagcgttgcagcgtgcgc
cagtggttgagcggcttgctcgacagcaacatgcagctgcgcgagtacgaatacctgccg
ctggtgactattcaggaacacagcgaattgcccaagggccagccgttgttcgacagcctg
ttcgtgttcgagaacgcgccggtggaagtctcggtgctggaccgtgcgcagagcctgaat
gctacgtccgattccgggcgtacccacaccaacttcccgctgactgccgtgtgttatccg
ggcgatgacctcggcttgcacctgtcctacgaccagcgttacttcgacgaaagcaccgtg
caaggcatgctcggcgagttcaaacgcttgctgttggcgctggtgcagggcttccatggc
gacatggccgagctggcgctgattggtgagcaggagcgtgaattcctcgtggacggctgc
aaccagagcgagcgtagctatccgctggaacgcagctacgttgagttgttcgaagaacag
gtggcgcaacatccgcaacgtatcgccgccagctgcctcgaccagcaatggagctacgac
gagctgaaccgccgcagtaacggcctgggccacgcgctgatcgcggcgggtgtcggcctg
gatcaaccggtggcgttgctggctgagcgtaacctcgacctgttgggcatgatcatcggc
agcttcaaggccggtgccggttacttgccgctggacccgggtcttcctagtcaacgtctg
agtcgaatcatcgacttgagccgcacaccgttgctggtgtgcaccgaggcgtgccgcgaa
caggccatcgagttgctcgaaggtgttgattgccagttgctggtgtgggaggaagtgccc
gcccgtggtgaaaacccaggggtctacagcggccccgacaacctcgcctacgtgatctat
acctcgggctccaccggcctgcccaagggcgtgatggtcgaacagcgcggcatgctcaat
aaccagttgagcaaggtgccgtacctggatctgactgatgcggacgtgatcgcccagacc
gcttcgcaaagtttcgacatttccgtctggcagttcctcgccgcgccgctgtttggtgcg
cgggtggatattgtgccaaacacccttgcccacgatccgcaaggtttgttggaacatgtt
caagcccacggcatcaccgtgctggagagtgtgccgtcgctgatccagggcatgttggcc
caggagcacatcagcctcgacggcctgcgctggatgctgccgaccggggaggcgatgcca
cccgagttggcccaccagtggctgttgcgttacccgcagattggcctggtcaatgcctac
ggcccggcggagtgctcggacgatgtagcgttcttccgcgtcgatctggcgtcgacccgt
ggcacttacctgccgattggcacaccgaccgacaacaaccgtttgtacctgctcgatggt
gcacttgagttggtgccccagggcgcggtcggtgaactgtgcgtcgccggcaccggtgtc
ggccgtggttatgtcagcgatccactgcgcaccgcccaggtctttgtgcccaacccattt
ggtgcaccgggcgagcgtctctatcgtaccggcgacctggcgcggcgccgcagtgatggc
gtgctggaatacgtcgggcgtatcgaccatcaggtgaagattcgcggctaccgcatcgaa
ctgggtgaaatcgaagcgcgcctgcacgaacagcccgaagtgcgcgatgcggcggtgggt
gtgcaagagggcgtcaacggcaagcatctggttggctacctggtggcagccgaccagacg
ttgaaggccggcgagcgcctggaccgcatcaagcaacgcctgcgtgccgagctgcccgag
tacatggtgccgctgcactggctctggctcgagcgcctgccactcaacgccaacggcaag
ctcgaccgcaaggctttgccggccctggagatcggccagttgcacagccaggactacctg
gcgccgcgcaatgaactggaaaccaccctggccgggatttgggccgaggtgttgaaggtt
gagcgggttggggtacaggacaacttcttcgaactgggcgggcactcgttgctggctacg
cagatcgcctcgcgggtgcagaaaaccctgcagcgcgatgtgccgttgcgagcgatgttc
gaatgcagcacggtggcggaattggccgagtatatcgacgggttggcggctaacgagatc
agtgccgagaaggtggatcggttgagtgatctgatggcggagctggagggcttgtaa

DBGET integrated database retrieval system