KEGG   Pseudomonas synxantha LBUM223: VO64_5181Help
Entry
VO64_5181         CDS       T03769                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pfb  Pseudomonas synxantha LBUM223
Pathway
pfb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pfb00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VO64_5181
Enzymes [BR:pfb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     VO64_5181
Transporters [BR:pfb02000]
 Other Transporters
  Pores ion channels [TC:1]
   VO64_5181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AKA85727
UniProt: A0A0E3KHN1
LinkDB All DBs
Position
5776492..5777094
Genome map
AA seq 200 aa AA seqDB search
MYKVYGDYKSGNCYKIKLMLNLLGIPYQWIDVDILNGDTETAEFLAKNPNGKIPVLELED
GTCLWESNAILNFLADGSEFLPTEPRLRTQVLQWQFFEQYSHEPYIAVARFIQFYLNMPE
DRLEEYKTTHKGGYKALRVMERQLQATPYLVGEQYSIADIALYAYTHVAHEGGFDLAPYP
AVQAWLQRVARHPKHVTMVD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggtttatggcgattacaagtcgggcaactgctacaaaatcaaactgatgctc
aatctgctgggcatcccgtatcaatggatcgatgtcgacatcctcaacggcgacaccgag
accgctgaattcctggccaagaaccccaacggcaaaatcccggtattggagctggaagat
ggcacctgcctgtgggagtccaatgcgattcttaactttctcgccgatggcagtgagttc
ttgcccacggaaccacgcctgcgtacccaagtattgcagtggcagtttttcgagcagtac
agccatgagccgtatatcgcggtggcgcggtttatccagttctacctgaacatgccggaa
gatcgccttgaggaatacaagaccacccacaagggcggttacaaagccttgagggtcatg
gagcgccagctgcaagccacgccgtacttggtgggtgagcagtattcaattgccgatatt
gcgctgtatgcctacacccatgtggcccatgaagggggcttcgacctggcgccttacccg
gcggtacaggcgtggttgcagcgcgtggccaggcatccgaaacatgtgacgatggtggat
taa

DBGET integrated database retrieval system