KEGG   Pseudomonas fluorescens A506: PflA506_2935Help
Entry
PflA506_2935      CDS       T02114                                 

Definition
(GenBank) trehalose synthase/maltokinase, putative
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PflA506_2935
Enzymes [BR:pfc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PflA506_2935
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PflA506_2935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3257451..3260798)
Genome map
AA seq 1115 aa AA seqDB search
MAKKPKAATFIKDPLWYKDAVIYQVHVKSYFDSNNDGIGDFAGLIAKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVHSDYGTMADAKRFIAQAHQRGLRVITELVINHTSDQHP
WFQRARKAKPGSAARDFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDLGIDGLRLDAIPYLIERDGTNNENLAETHNVLKQIRA
EIDAHYPDRMLLAEANQWPEDTQLYFGDRKGDDGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDKERDYLWNYYAADRRARINLGIRRRL
APLVERDRRRVELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRADPASLVLPPIMDPQYGYQSVNVETQAQDPHSLLNWTRRMLAVRKQSKAFGRGSLKM
LSPTNRRILAYTREYTGEDGHTEIILCVANVSRSAQAAELDLSAFAGMVPVEMLGGNAFP
PIGQLNFLLTLAPYGFYWFVLAAENQMPSWHVEPAQSMPDFTTLVLKKRMEELLEEPCRT
SLEHTSLPAWLPKRRWFAGKDTAIDTVHIAYGVRFGDPQHPVLLSEIEVTSAGQVSRYQL
PLGFLGEDQFTSALPQQLALARVRRTRQVGLVTDAFSLEHFILEVIQAMQAGTVLNTPDG
DLRFEATHHLAALQLTRESPVRYLSAEQSNSSVVVGESLVLKLIRKVSAGVHPELEMSAY
LTAAGYPNISPLLGFMSRQDGQGQDNLLMIAQGYLSNQGDAWSWTQNNLERAIRDELADA
ISEQEQHYNALGELADFAGLLGQRLGEMHLVLGAPTADKAFKPEPTTIKDTQAWAKDVGA
QIDRALQLLKLNQSQLNPADQALVSELLAQKKAIAAHVQALAKATAGGLRIRVHGDLHLG
QVLVVKGDAYLIDFEGEPARPLHERRGKHSPYKDVSGVLRSFDYAAAMALNVQGVDHTPE
ANAARKRVTDRYLNEARVAFTQAYQAAASTLAHDWQDANGQDAALTLFSLEKAAYEVAYE
AENRPTWLPVPLQGLHGLLSGLTPISKPVRGGETS
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaacccaaggcagccaccttcatcaaagacccgctctggtacaaagacgcg
gtgatctaccaggtacacgtcaaatcctatttcgactccaataacgacggcattggtgac
tttgctgggctgatcgccaaactcgactacatcgctgacctgggcgtgaacaccatctgg
ctgctgccgttctacccgtctccccgccgtgatgacggctacgacattgccgaataccgc
ggcgtgcacagcgactacgggacgatggccgacgccaagcgctttattgcccaagcccat
caacgcgggctgcgcgtgatcaccgagcttgtgatcaaccacacctccgaccagcacccc
tggttccagcgtgcgcgcaaggccaagccaggctcggcggcgcgggacttttatgtgtgg
tcggacgatgaccagaaatacgacggcacacgcattattttcctggacaccgaaaagtcc
aactggacctgggacccggtggccggccagtacttctggcaccgcttttactcgcaccaa
ccggacctcaacttcgataacccgcaggtcatgaaagcggtgctgtcggtgatgcgctat
tggctcgacctgggcatcgacggcctgcgcctggacgccattccctatctgatcgaacgg
gacggcaccaacaacgaaaacctggcggaaacccacaacgtcctcaagcagatccgcgct
gagatcgatgcccattatcccgaccgcatgctgctggccgaagccaaccagtggccggaa
gacacgcagctgtactttggggatagaaagggtgatgacggcgatgaatgccacatggcc
tttcactttccactgatgccgcgcatgtacatggcgttggcccaggaagatcgcttcccc
attaccgacattctgcgccagaccccggagattcccgccaactgccagtgggcaattttc
ctgcgcaaccatgatgagctgaccctggaaatggtcaccgacaaagagcgcgactacctg
tggaactactacgccgcagaccgccgcgcccgcatcaacctgggcattcggcgacgcctg
gcgccgctggtggagcgcgatcgtcggcgggtggaattgctcaacagcctgttgctgtcg
atgccgggcacgccgaccctgtactacggcgatgaaatcggcatgggcgacaacatctac
ctgggcgaccgtgacggcgtgcgcacgcccatgcaatggtccatcgaccgcaatggcggg
ttttcccgtgccgacccggccagtctggtgttgccgccgatcatggacccgcaatacggc
taccagtcggtcaacgtcgagacccaggcccaggacccgcattcattgctcaactggacc
cggcgcatgctcgcagtgcgcaagcagtccaaggcgtttggtcgtggcagcttgaaaatg
ctctcgccgactaaccggcgcatcctggcttacacccgtgaatacaccggtgaagacggc
cacaccgagatcatcctgtgcgtggccaacgtgtcgcgcagcgcccaggcggcggagctg
gacctgtcggcctttgccggcatggtgccggtggagatgcttggcggtaatgccttcccg
ccaatcggccagctgaatttcctgctgaccctggcgccctatggtttctattggttcgtg
ctggcagcggaaaaccagatgcccagctggcatgtggaaccggcgcaaagcatgcccgac
ttcaccactttggtactgaaaaaacgcatggaagagctactcgaagaaccttgccgcacc
agcctggaacatacgtcactgcccgcctggctgcccaagcggcgctggtttgccggcaaa
gatacggcaatcgacacggtgcacatcgcatatggcgtgcgttttggcgacccgcagcat
ccggtgttgctcagtgagatcgaagtgaccagtgccggccaggtcagccgctaccaactg
cccttgggcttccttggcgaagaccagttcaccagcgccttgccccagcaattggcgttg
gcccgagtgcgacgcacccgccaggtaggtttggtgaccgatgccttcagccttgagcat
tttatccttgaggtgatccaggccatgcaggccggcaccgtgctcaatacccctgacggc
gatctgcgattcgaggccactcatcacttggccgcattgcaactgacccgtgaatcgccg
gtgcgttacttgtccgccgagcagtccaacagctcggtggtggtcggtgagagtctggtg
ctcaagctgattcgcaaagtcagcgccggcgtgcacccggagctggaaatgagtgcgtac
ctgaccgccgctggctacccgaacatctcgccgctgctgggctttatgagccgccaggac
gggcagggacaggacaacttgctgatgattgcccagggttacttgagcaatcagggcgat
gcctggagctggacccagaacaacttggagcgggcgatccgcgatgagctggccgacgcg
atctctgaacaggaacagcattacaacgccctcggggaactggcagattttgccggtttg
ctcggtcagcgcctgggtgaaatgcacctggtgctgggtgcgccaacggccgacaaggcc
ttcaaacccgaacccaccacaatcaaagacacccaagcctgggccaaggatgtcggcgcc
cagatcgaccgtgccttgcagttgctcaagcttaatcaaagccagttgaaccccgccgac
caggcgttggtcagtgaattactggcgcagaaaaaagccatcgcggcgcatgtccaggcg
ttggccaaagccacggcgggcggattgcgcattcgcgtccacggtgacttgcacctgggc
caggtattggtggtcaagggcgatgcctacttgatcgacttcgagggcgaaccggcgcga
ccgctgcatgagcggcgcggcaaacacagcccttataaagatgtgagcggtgtgctgcgt
tcctttgattatgccgcggccatggcgctgaatgtacaaggggtggatcacacgccagaa
gcgaacgctgcgcgcaaacgcgtgaccgaccgctacctgaatgaagcccgcgtagcattt
acccaggcttaccaggccgctgcgtctacactggcgcatgactggcaggatgccaacggc
caagacgcagcgctgaccttgttcagcttggaaaaggccgcgtacgaagtggcctacgaa
gcagaaaaccgcccgacttggctgccggtgcccctgcaagggctgcacggcttgttgagc
gggctgacacctatatctaaacctgtacgcggtggggagacgtcatga

DBGET integrated database retrieval system