KEGG   Pseudomonas fluorescens A506: PflA506_3691Help
Entry
PflA506_3691      CDS       T02114                                 

Gene name
pvdL
Definition
(GenBank) non-ribosomal peptide synthetase PvdL
Organism
pfc  Pseudomonas fluorescens A506
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4090499..4103395)
Genome map
AA seq 4298 aa AA seqDB search
MMDAFELPRTLVQSLQQRAAQTPDQVALRFLAESAEHSVVLSYRDLDQRARTIAAALQAN
AGLGERAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESTRRHHQERLLSIISDAEPRLL
LTIASLSEGLAQIENAPKVLSVDTLEAQQADQWVAPDLKADDIAFLQYTSGSTALPKGVQ
VSHGNLVANEVLIRRGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLMSPAY
FLGRPLRWLEAISEYGGTISGGPDFAYRLCSERVSESALERLDLSRWRVAYSGSEPIRLD
TLERFAEKFAACGFTPNNFFASYGLAEATLFVAGGTRGRGIPALRLDEQALAANRAEPGQ
GPAIMSCGTSQPDHAVLIADPHTLTELPDQCIGELWATGPSVAHGYWRNPEASAKTFVQH
AGRTWLRTGDLGFIRDGEVYITGRLKDLLIVRGHNLYPQDIEQTIEREVEGVRKGRVAAF
AVNDQGLEGIGIAAEISRSVQKILPPEALIKAIRQAVAEACQQAPSVVVLLNPGALPKTS
SGKVQRAACAIRHADGSLDSYAQFPGQQGQASEVALESDLQQRIAAIWCEQLQLAQVAGD
DHFFLLGGNSITATQVVARLRESLGLELNLRLLFEAPTLAAFAAAVAQLQQDGGVAQGAM
HALSRQEDLPQSLAQNRLWITWQLDPHSSAYTIPGALHLRGELDEDALRQSFQQLIQRHE
ALRTRFYERDGQAFQRVEATADFELSIIDLSDLPNTEREARAQQVREDQARSPFDLETGP
LLRVTLVRLGDEEHQLLVTLHHIIADGWSLNILIDEFSRLYAAAAQGQSLALPPLALQYA
DYGSWQRQWLAEGEGQRQLTYWTAQLGDEHPALNLATDHPRAAQHRHSASRHSQRLDARL
SAAIRQTAQAHDSTSFMLLLATFQTLLYRYSGQRDIRIGVPNANRPRHETQGLIGFFINT
LVLRAELDGRLPFNQLLAATRETTLAAQAHQDLPFEQLLEAFPQAREQGLFQVMFNHQQR
DLSALRRLPGLLADELPWHSREAKFDLQLHSEEDRNGRLSLSFDYADELFDCATIQRLAE
HFIHLLHAVCAQPQHAIGDLPLMQADEQQPWSEAPCAPARHWLPQLLNQQTSDATALVWQ
DGSLTFAQLHTQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLAIIKAGGAYVPLDP
DYPAERLAYMLKDSGVQLLLTQTALLPQLPSAEGVCVIAMDSLHLDSWPTQAPGLHLHGD
NLAYVIYTSGSTGQPKGVGNTHGALAERLQWMQATYQLNETDVLMQKAPISFDVSVWECF
WPLITGCRLVLAGPGEHRDPHRIAQLVQEHGVTTLHFVPPLLQLFIDEPLAAECTSLRRL
FSGGEALPAELRNRVLARLPAVQLHNRYGPTETAINVTHWQCAASDGESSPIGRPLGNVI
CRVLDEQLNPLPAGVPGELCIGGIGLARGYLSRAGLTAERFVADPLGAAGTRLYRTGDRA
RWNADGVLEYLGRLDQQVKLRGFRVEPEEIEARLLAQAGIAQAVVLVRDAQLIGYYTADA
ELDEQRVKIALAAELPEYMVPALLMRLDAMPLSPSGKLDRRALPEPVWQTREHVEPHTPL
QLQIAAIWREVLGLPRIGLRDDFFALGGHSLLATQIISRTRQACDVELPLRTLFEASELG
DFAEQVGLIQAAGQRNQQMAIAKVDRSQPVPLSYSQQRMWFLWQMEPDSPAYNVGGMARL
RGVLDVGRFEAALQALIMRHETLRTTFPSVDGVACQKVSAQTNVRMDWQDFSALNEPQRQ
QRLQQLADVEAHTPFNLETGPLLRACLVKAGEQEHYLVLTLHHIVTEGWAMDIFARELSA
LYEAFIDERDSPLPTLPVQYLDYSVWQRQWMEAGERQRQLDYWTAQLGNEHPLLELPGDR
PRPPVQSHRGELYRFDLSDELAARVRAFNAQHGLTLFMTMTATLAVLLYRYSGQTDLRIG
APVANRIRPESEGLIGAFLNTQVLRCQLTGQMRVSELFEQVRHTVIEGQSHQDLPFDHLV
EALQPPRSAAYNPLFQVMCNVQRWEFQQSRQLAGMTVEYLANDARATKFDLNLEVTDLDH
RLGCCLTYSTDLFDEPRIARMAEHWRNLLEALVADPGQRLSELPLLSADEQRALQDSLGV
GKGEHRLDQCIHQLFSQQASQRPEAPALTFAGVTLSYAQLDERANRLAWMLRERGVGPQV
RVGLALPRSLEMVIGLLAILKAGGAYVPLDPEYPLDRLHYMIEDSGIGLLLSDAALFEAL
GELSATVACWCLEDDSPVLANYPAEALPLVSLAQHQAYLIYTSGSTGKPKGVVVSHGEIA
MHCQAVIERFDMRPDDCELHFYSINFDAATERLLVPLLCGARVVLRAQGQWDAEEICALI
RTHRINVLGFTPSYGSQLAQWLATQQQTLPVRMCITGGEALTGEHLQRIRAAFTPQLFFN
AYGPTETVVMPLASQAPEQLEEGAGSVPIGSIVGERVAYILDADLALVPQGASGELYIGG
AGLALGYHQRPGMTAERFVVDPFAGKGGRLYRTGDLVRQRADGLVEYLGRIDHQVKIRGF
RIELGEIETRLLEHDAVREAVVLALDAPSGKQLVAYLVSDAEHAALRDALKAHLKAQLPD
YMVPAHLIVLQSMPLTANGKLDRRALPEPDPEANRQAYVAPRSELEHSLAAIWCAVLNVE
QVGLDDNFFELGGDSILSIQVVSRARQAGIHFSPRDLFQHQTVQSLAAVATRSELIIAEQ
GLLTGPSGLTPIQHWFFDTDIPARQHWNQALVLKPLQLLDAHRLEQALLAVLEHHDALRL
SFTPRGAQWHAEHLGVPEGGVLLQAQVRDMQACTALFTDTQRSLDLAQGPLLRALLVDGP
QGQQRLLIAIHHLVVDGVSWRVLLEDLQNVYRQLSEGQSVSLPAKTSALRDWAARLQAYA
HSESLREESSLWQALLAGPAVTLPVQRPHGTLRNCDADTVSVRLDAERTRQLLQQAPSAY
RTQVNDLLLTALARVLCRWSGQASALIQLEGHGRETLFDDIDLTRSVGWFTSAYPLRLTP
QAEQGDSIKAIKEQLRGVPHKGLGYGVLRYLADDLCKQSMAALPSAQITFNYLGQFDQSF
GADALFHPLEETAGLAHDPDAPLPNELSIDSQVYGGELVLRWTFSRERHDQQVIRDLAEA
YLAELHSLIAHCLQDDAGGLTPSDFPLAHLTQVQLDALPVPASAIEDVYPLTPMQEGLLL
HTLLEPGTGLYYMQDRYRINSALDPERFAQAWQAVIARHEALRASFCWNVGEDMLQVIHK
PGSTPIEYLDWSADPQDEQEPRLQALLKAEREAGFDLLNQAPFHLRLIRVAEARYWFMMS
NHHILIDAWCRSLLMNDFFDIYTALGEGRDAQLAAPPRYRDYIAWLQRQNLNEARQWWQQ
NLQGFERATPIPSDRPFLREHAGGSGGMVVGDCYTRLDARDGALLRELAQAHQLTVNTFA
QAAWALVLRRLSGDRDVLFGVTVAGRPVDMPEMQRTVGLFINSIALRVKLPEDGQRCSVR
QWLSALLDSNMQLREYEYLPLVTIQEHSELPKGQPLFDSLFVFENAPVEVSVLDRAQSLN
ATSDSGRTHTNFPLTAVCYPGDDLGLHLSYDQRYFDESTVQGMLAEFKRLLLALVQGFHG
DMDELALMGEQEREFLVEGCNQSAHAYPLERSYIELFEAQVAQHPQRIAASCLDQQWSYE
DLNRRSNGLGHALIAAGVGLDQPVALLAERGLDLLGMIIGSFKAGAGYLPLDPGLPGQRL
SRIIDLSRTPLLVCTEACREQAIELLEGVDCQLLVWEEIPARGENPSVYSGPDNLAYVIY
TSGSTGLPKGVMVEQRGMLNNQLSKVPYLNLSDADVIAQTASQSFDISVWQFLAAPLFGA
RVDIVPNTIAHDPQGLLAHVQAQGITVLESVPSLIQGMLAQERIRLDGLRWMLPTGEAMP
PELAHQWLLRYPQIGLVNAYGPAECSDDVAFFRVDLASTRGTYLPIGTPTDNNRLYLLDG
ALELVPQGAVGELCVAGTGVGRGYVSDPLRTAQVFVPNPFGAPGERLYRTGDLARRRSDG
VLEYVGRIDHQVKIRGYRIELGEIEARLHEQPDIRDAAVGVQEGVNGKHLVGYLVAADAT
LNTGERLERIKQRLRAELPEYMVPLHWLWLDRLPLNANGKLDRKALPALEIGQLHSQDYV
TPRTELEATLAAIWAEVLRVERVGVRDNFFELGGHSLLATQIASRVQKTLQRDVPLRAMF
ECSTVAELAEYIDGLAANEISAEKVDRLSDLMAELEGL
NT seq 12897 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgccttcgaactcccccgcaccctggtccagtcccttcaacagcgtgctgcg
cagacaccggatcaggtggcgttgcgcttcctcgccgagagcgccgagcacagtgtggtg
ctcagttatcgcgacctcgaccaacgcgcccgcaccatcgccgctgccctgcaggccaac
gctggcctgggcgagcgtgcggtgttgctgttccccagtggtccggactatgtggcggcg
ttctttggctgcctgtacgccggggtgatcgcggtgccggcgtatccgccggaatccacg
cgccgtcatcaccaggagcgcctgctgtcgatcatcagcgatgccgagccgcgcctgctg
ttgaccattgccagcctcagcgagggcctggcgcagattgaaaacgcgcccaaggtgttg
agcgtcgacaccctggaggcgcagcaggccgaccagtgggtcgcgcccgacctcaaggcg
gacgacatcgcgttcttgcaatacacctccggctccaccgcattgcccaagggcgtgcaa
gtcagccacggcaacctggtggccaacgaagtgctgatccgccgtggttttggcatcgac
ctcaaccccgatgacgtgatcgtcagctggttgccgctgtaccacgacatgggcctgatc
ggcggcctgctgcaaccgatcttcagcggcgtgccctgcgtgttgatgtcgccggcctac
ttccttggccgacctttgcgctggctggaggcgatcagcgaatacggcggtaccatcagc
ggtggcccggacttcgcctaccgcctgtgcagcgaacgggtcagtgagtcggccctggag
cgcctggatttgagccgctggcgcgtggcctattcgggttccgaaccgatccgcctcgac
accttggaacgcttcgcggaaaaattcgccgcctgtggtttcaccccgaataatttcttc
gcctcctacggcctggccgaagccaccctgtttgtcgccggcggtacccgtggccgtggc
attcccgccctgcgcctggacgaacaggcgctggccgccaaccgtgccgaaccggggcag
ggccctgcgatcatgagttgcggcaccagccagccggaccacgccgtgctgatcgccgac
ccgcacaccctcaccgagctgcccgaccagtgcatcggcgaactctgggccacgggcccg
agcgtcgcccacggctactggcgcaaccccgaagccagcgccaagaccttcgtccagcat
gctggccgcacctggttacgcaccggtgacctgggctttatccgcgacggtgaggtgtac
atcaccgggcgcctgaaagacctgctgatcgtgcgcggccataacctctacccccaggac
atcgaacagaccatcgagcgcgaagtggaaggggtgcgcaagggccgggtcgccgcgttt
gcggtcaatgaccagggcctggaaggcatcggcatcgctgcggaaatcagccgcagcgtg
cagaaaatcctgccgcccgaagcgctgatcaaagcgatccgccaagccgtggccgaggcc
tgccagcaagctccgagtgtggtggtgctgctcaaccccggcgccttgccgaagacctcc
agcggcaaagtgcagcgtgcggcctgtgcgattcggcatgccgatggcagcctcgacagc
tacgcgcagttccccgggcagcaggggcaggcgagcgaagtggcgctggaatcggacctg
caacagcggatcgcggcgatctggtgcgagcaactgcaactggcccaggtggcgggcgac
gatcactttttcctgctggggggcaactccatcaccgcgacccaagtggtcgcccgcctg
cgcgaaagcctggggctggagctgaacctgcgcctgctgttcgaagcgccgacactcgcg
gcctttgctgcggctgtggcgcaactgcaacaggacggcggcgtggcccaaggcgcaatg
cacgccttatcgcgtcaagaagacctgccccaatccctggcacagaaccgcctgtggatc
acttggcaattggaccctcacagcagcgcctacaccattccaggcgccttgcacctgcgc
ggcgagctggatgaagacgcactgcgccaaagcttccagcaactgatccagcgtcacgaa
gccctgcgcacgcgcttctacgagcgcgatggtcaggcgtttcagcgtgtcgaggctacg
gcggatttcgaactgtcgatcatcgacctcagcgacctgcccaacaccgagcgcgaagcc
cgtgcgcaacaggttcgtgaagaccaggcgcgcagcccgttcgacctagaaacaggcccg
ttgctgcgggttaccctggtgcgcctgggcgatgaagagcaccaactgctggtgacgctg
caccacatcattgctgacggttggtcgctgaatatcctgatcgacgagttctcgcgcctg
tacgccgctgccgcccaaggccagtccctggcgttgcccccgctggccttgcaatacgcc
gactacggcagctggcagcgccaatggctggccgaaggcgagggccagcgacagctgacg
tactggacagcgcagttgggtgacgagcatccggccctgaacctggccaccgatcacccg
cgtgccgcccagcatcggcacagcgcctcgcgccatagccagcgcctggatgcgcgcctc
agtgcggcgattcgccagaccgcccaggcccacgactcaacatcgttcatgctgttgttg
gcgacgttccagaccttgctctatcgctacagtggccagcgcgatatccgtatcggcgtg
cccaatgccaaccgcccacgccatgaaacccagggcctgatcggcttctttatcaacacc
ctggtgctgcgcgccgagctggacgggcgcctgccgttcaaccagctgttggccgccact
cgcgagaccacattggccgcccaggcccatcaggacctgccctttgaacaactgctggaa
gccttcccccaggcccgcgaacagggcctgttccaggtcatgttcaaccaccagcagcgc
gacctcagcgccttgcgccgcctgccgggcctgctggccgatgagttgccctggcacagc
cgcgaagccaagttcgacctgcaactgcacagcgaagaagaccgcaacgggcgcttgagc
ctgtcgttcgactacgccgacgagctgtttgattgcgcgaccatccagcgtctggccgag
cacttcatccatctacttcacgctgtgtgcgcgcaaccacaacacgccatcggcgatctg
ccgttgatgcaggctgacgaacagcaaccctggagcgaagccccctgcgcgccggcccgg
cactggctgccccagctgctcaaccaacaaacgtcggacgccaccgcattggtctggcag
gacggcagcctgaccttcgcccaattgcacacccaggccaaccgcctggcccattacctg
cgcgacaaaggcgtcggcccggacgtgtgcgtggccatcgccgccgagcgttcgccgcaa
ctgctgatcggcctgctcgccatcatcaaggccggtggcgcctacgtgccgctggacccg
gattaccccgccgagcgcctggcctacatgctcaaggacagcggcgtgcaactgctgctc
acccagaccgcgttgctgccccaactgcccagcgccgaaggcgtgtgcgtgattgccatg
gacagcctgcatctggacagctggccgacccaggcgccaggcttgcacctgcacggcgat
aacctcgcctacgtgatttacacctccggttccaccggccaacccaaaggcgtgggcaac
acccatggcgccctggccgagcgtttgcagtggatgcaggccacctatcaactgaacgaa
accgatgtgctgatgcaaaaggcgccgatcagtttcgacgtgtcggtgtgggaatgcttc
tggccactgattaccggctgccgcctggtattggctgggccgggcgaacatcgcgacccg
caccgcatcgcgcagcttgtgcaggaacatggggtgaccacgctgcacttcgtgccaccg
ttgttacagctgtttatcgatgaacccctggcagccgaatgcaccagcctgcgtcgcctg
ttctccggtggcgaagccttgcccgccgagttgcgtaaccgcgtactggcgcgcttgccc
gcggtgcaattgcacaaccgctatggcccgaccgaaaccgcgatcaacgtcacccactgg
cagtgcgccgcctcggatggcgagagctcgccgattggccggccattgggcaatgtgatc
tgccgcgtactggacgagcaactcaacccgctaccggccggtgtgccgggcgaattgtgc
atcggcggtatcggcctggcgcggggttacctgagccgtgccgggctgacggccgaacgt
tttgtcgccgacccgctgggcgcggcgggcacccgcttgtatcgcaccggtgaccgtgcg
cgctggaacgccgatggtgtgctcgaatacctcggacgcctcgatcagcaggtcaaactg
cgcggtttccgggtggaaccggaagaaatagaagcgcgcctgctggcccaggcaggcatc
gcccaggccgtggtgctggtacgtgatgcccagttgatcggctactacaccgccgacgcc
gaactggatgagcaaagggtcaaaatcgccctggctgccgagttgccggagtacatggtg
cccgcgctgctgatgcgcctggacgccatgcccctgagccccagcggcaagctcgaccgg
cgtgccttgccagagccggtatggcaaacccgcgaacacgtcgaaccgcacacacctttg
cagctgcaaatcgccgcgatctggcgcgaggtgcttggcctgccacgcatcggcctgcgc
gatgactttttcgcactcggcgggcactcgttgctggccacgcaaatcatctcccgcacc
cgccaggcctgcgacgtcgaactgccgctgcgcaccctgttcgaagccagcgagctgggc
gatttcgccgagcaggtcgggctgatccaggcggcgggccagcgcaaccaacagatggcc
atcgccaaagtcgaccgcagccagccggtccccttgtcctattcccagcagcgcatgtgg
ttcctctggcagatggaaccggacagcccggcctacaacgtcggcggcatggcgcgcctg
cgcggcgtgctggatgtgggacgtttcgaggccgccttgcaggccttgatcatgcgtcac
gaaaccctgcgcaccactttccccagtgtcgatggtgtggcctgtcaaaaggtctcggcg
caaaccaatgtgcgcatggactggcaggatttctccgcgctgaatgagccgcagcgccag
cagcgtttgcagcaactggccgatgtcgaggcgcacacgccgttcaacctggaaaccggg
ccgctgttgcgcgcctgcctggtcaaggccggcgagcaggaacattacctggtgctgacc
ctgcaccatatcgtcaccgaaggctgggccatggacatctttgcccgtgaactcagcgcc
ttgtatgaagcctttatcgacgagcgcgactcaccgctgccaacgttgccggtgcagtac
ctcgactacagcgtatggcaacgccagtggatggaagccggtgagcgccagcgtcagctg
gactactggaccgcccaactgggcaacgaacacccgttgctggaattgcccggcgaccgt
ccacggccaccggtgcaaagccatcggggcgagctgtaccggtttgatttgagcgatgag
ctggccgcccgcgtgcgagccttcaacgcccagcacggcctcacgctgttcatgaccatg
accgcgaccctggcggtgttgctctaccgctacagcggccagaccgacctgcgcatcggc
gcgccagtggccaaccgtatccgtccggaaagcgaaggcttgattggcgcgttcctcaat
acccaggtgctgcgttgccagctcactgggcagatgcgggtcagcgagctgttcgagcag
gtgcgccataccgtgatcgagggccagtcccaccaggacctgccgttcgaccatctagtg
gaagccctgcaaccgccgcgcagcgcggcgtacaacccgttgttccaggtgatgtgcaac
gtgcagcgctgggaattccagcaaagccgccaactggctggcatgaccgtggagtacctg
gccaacgatgcgcgggcgaccaagttcgacctcaacctggaagtcaccgacctcgaccat
cgcctgggttgctgcctgacctacagcaccgacctgttcgacgagccgcgtattgcgcgt
atggccgagcattggcgcaacttgcttgaagcgttggtcgccgatcctggccagcgcctg
agcgaattgccgttgctgagcgcagatgaacaacgcgccttgcaagacagcctgggggtg
gggaagggcgagcatcgcctcgaccagtgcatccatcaactgttcagccagcaggccagc
cagcggccggaggccccggcgctgacctttgccggtgtgaccctctcgtatgcgcaactg
gatgagcgcgccaaccgcctggcctggatgctgcgcgagcgtggcgtgggcccgcaggtg
cgcgtgggcctggcgctgccgcgttcgctggaaatggtcatcggtttgctggcgatcctc
aaggccggcggtgcctatgtgccgctggaccccgaatacccgctggatcgcttgcattac
atgatcgaagacagtggcatcggcctgctgctcagtgatgcggccctgttcgaagccctg
ggtgaattgtcggcgacggtggcgtgctggtgcctggaggatgactcgccggtgctggcc
aattaccccgccgaggcgctgccgctggtgagcctggcgcaacaccaggcgtacctcatc
tacacctcgggttccacgggcaagcccaaaggtgtggtggtgtcccacggtgagatcgcc
atgcattgccaggcagtgatcgagcggtttgacatgcgcccggatgactgcgaactgcac
ttttactcgatcaacttcgacgctgccaccgaacgtttgctggtgccgctgctgtgcggg
gcgcgggtggtattgcgcgcccagggccagtgggatgccgaagagatctgcgcgctgatc
cgtacccatcgcatcaatgtgctcggtttcacccccagctacggcagccagttggcgcag
tggctggcgacccagcaacagacactgccggtgcgcatgtgcatcaccggtggcgaagcc
ttgaccggcgaacacctgcaacgcatccgtgcggcgtttacgccccagctgttcttcaac
gcctacggccccaccgaaaccgtggtgatgcccctggccagccaagcgcccgagcagttg
gaggagggcgctggcagtgtgccgatcggtagcatcgtcggcgagcgcgtggcttacatt
ctcgacgccgacctggcgctggtaccccagggtgccagcggtgagctgtacatcggtggc
gcaggcctggccctgggttatcaccagcggccggggatgacggcggagcgctttgtcgta
gacccgtttgctggcaagggcgggcgcctgtaccgcaccggcgacctggtacgccaacgc
gccgatggcctggtggagtacctggggcgcatcgaccatcaggtgaagattcgcggtttt
cgcatcgaactgggcgaaatcgaaacgcgcttgctcgaacatgacgctgtgcgcgaagcg
gtggtgctggcactggatgcgccgagcggcaagcaattggtggcgtacctggtcagcgat
gccgagcacgccgctttgcgcgacgcgttgaaggcgcacctcaaggcgcaactgccggac
tacatggtgcccgcgcatctgatcgtgctgcagagcatgccgctgaccgccaacggcaag
ctcgaccgccgtgccttgcctgagccggacccagaggccaatcgccaagcctacgtcgcg
ccgcgcagcgagctggaacacagcctggccgccatctggtgcgcggtgctgaacgtggag
caagtgggcctcgacgataacttctttgaactgggcggcgactcgatcctgtcgatccag
gtggtgagccgggcgcgccaggccgggattcatttcagcccccgtgacctgttccagcac
cagaccgtacagagcctggctgccgtggcgactcgctcggagctcatcatcgccgagcaa
ggattgctgaccggcccctcgggcctcacgccgatccagcactggttcttcgacaccgac
atcccggctcgccagcactggaaccaggcgttggtgctcaagccactgcaactgctcgat
gcccatcgcctggagcaagcgctgctggccgtgctggaacaccacgacgcgctgcgcttg
agctttaccccgcgtggcgcgcaatggcatgccgagcacttgggcgtgccggaaggtggc
gtgctgctgcaggcgcaggtgcgcgacatgcaggcgtgcacggcgttgttcaccgacacc
cagcgcagcctcgacctggcacaggggccgctgttgcgcgccttgctggtggacgggccg
caaggccagcagcgcttgctgatcgccatccatcacctggtggtggacggcgtgtcgtgg
cgcgtcctgctggaagacctgcaaaacgtttatcgccaactcagtgaaggccagtccgtc
agcctgccggccaagaccagcgcgctgcgcgattgggcggcgcgcttgcaagcctatgcc
cacagtgaatccctgcgcgaagagtcgagcctgtggcaagccctattggctggccccgcc
gtgaccttgccggtgcagcgcccacacggaacattgcgaaactgcgatgccgacacggtc
agcgtgcgcctggatgccgagcgcacccggcagttgctgcaacaggcgccgagtgcctat
cgcacccaggtcaacgacctgttgctcaccgccctggcccgcgtactgtgccgctggagc
gggcaggcctcggcactgatccagctggaaggccatggccgcgaaaccttgttcgatgac
atcgacctgacccgcagcgtgggctggttcaccagtgcctatccgttgcgcctgacgccg
caggccgagcagggcgactcgatcaaggcgatcaaggagcaactgcgtggtgtgccccat
aaaggcttgggttatggcgtgctgcgttacctggccgatgacctgtgcaaacagagcatg
gccgccttgccgagcgcgcagatcaccttcaactacctgggccagttcgaccagagtttc
ggcgctgacgcgttgttccatccgctggaggaaaccgccggtctggcccatgacccggat
gcgccgttgcccaatgaactgagcatcgacagccaggtctacggtggcgagctggtgctg
cgttggacgttcagccgtgagcgtcatgatcagcaggtgattcgcgatctggccgaggct
tacctggccgaattgcacagccttatcgcccattgcctgcaggatgatgccggcggcctc
acgccgtccgacttccccctggcacacctgacccaggtgcaactggacgccttgccggta
cccgccagcgccatcgaagacgtctacccgctgaccccgatgcaagagggcctgctgctg
cacaccctgctggagccgggcaccggcctgtattacatgcaggaccgctaccgcatcaac
agcgccctggacccggagcgttttgcccaggcctggcaagcggtgatcgcccgccacgaa
gccttgcgtgcctcgttctgctggaacgtcggcgaagacatgctgcaagtgatccacaag
cccggcagcacgccgattgagtacctggactggagcgccgacccgcaggatgagcaggag
ccgcgcctgcaagccttgctcaaggccgagcgcgaagccggctttgacctgctcaatcaa
gcacctttccacttgcgcctgatccgcgtggccgaggcgcgctactggttcatgatgagc
aaccaccacatcctgatcgatgcctggtgccgttcgctgctgatgaatgacttcttcgat
atctacacagccctgggcgaaggccgcgatgcgcaactggccgcgccgccgcgctaccgc
gactacattgcctggctgcaacgccagaacctcaacgaagcgcgccagtggtggcagcaa
aacttgcaaggcttcgagcgcgccacgccgatcccgagcgaccgcccgttcctgcgcgaa
cacgctggtggcagcggcggcatggtggtgggcgactgctacacccgcctggatgcccgc
gacggtgcgctactgcgcgaactggcccaggcgcatcagcttaccgtcaacaccttcgcc
caggcggcgtgggccctggtgctgcggcgtttgagtggtgatcgcgatgtgttgttcggc
gtcaccgtggccgggcgcccggtggacatgcccgagatgcaacgtaccgtcggcctgttt
atcaacagcatcgcgttgcgggtaaaactgcccgaggacggccagcgctgcagcgtgcgc
cagtggttgagcgccttgctcgacagcaatatgcaattgcgcgagtacgaatacctgccg
ctggtgacgatccaggagcatagcgaactgcccaagggccagccgctgttcgacagcctt
tttgtgttcgagaacgcgccagtggaagtctcggtgctggaccgtgcgcaaagcctgaac
gccacctcggattctggccgtacccacaccaacttcccgctgacggcggtgtgctatcca
ggcgatgacctcggtttgcacctgtcctacgaccagcgttatttcgacgaaagcaccgtg
caaggcatgctcgctgaattcaagcgcctgttgctggcgctggtgcagggcttccatggt
gacatggacgagctggcgctgatgggtgagcaggaacgtgaattcctcgtggaaggctgt
aaccagagcgcacatgcctacccgctggaacgcagctatatcgagttgttcgaggcgcag
gtcgcgcagcatccgcagcgtatcgccgccagttgtcttgaccagcaatggagctacgag
gatctgaatcgccgcagcaatggcctcggccacgcgctgattgcggcgggtgtcggcctg
gaccaaccggtggcgttgttggctgaacgtgggctggatttgctcggcatgatcatcggc
agcttcaaggccggcgccggctacctgccgttggacccgggcctgccgggccagcgcctg
agccgcatcatcgacctgagccgcacgccgttgctggtgtgcaccgaggcgtgccgtgaa
caggccatcgagttgctcgaaggtgtcgattgccagttgctggtgtgggaggaaattccc
gcccgtggtgaaaacccaagtgtctacagtggcccggacaaccttgcttacgtgatctac
acctcaggctccaccggcttgcccaagggtgtgatggtggaacagcgcggcatgctcaac
aaccaattgagcaaggtaccgtacctgaacctgagcgatgccgatgtgatcgcccagacc
gcgtcgcaaagcttcgatatttctgtgtggcagttcctcgccgcgccgctgtttggcgcg
cgtgtggacattgtgcccaataccatcgcccatgatccgcaagggttgttggcccacgtt
caagcacagggcatcaccgtgctggagagtgtgccgtcgctgatccagggcatgttggcc
caggagcgtatccgcctcgacggcctgcgctggatgttgccgaccggggaggccatgcca
cctgagctggcccatcagtggctgctgcgttacccgcaaattggcctggtgaatgcctac
ggcccggcggaatgctccgatgatgtggcgttcttccgcgtcgatctggcgtcgacccgt
ggcacttacctgccgattggtacgccgaccgacaacaaccgtttgtacctgctcgatggc
gcattggaactcgtgccccaaggcgccgtgggcgagttgtgcgtcgctggcaccggtgtc
ggtcgcggttacgtcagcgatccgttgcgcaccgcccaggtgtttgtacccaaccccttt
ggcgcgcctggtgagcgcctctaccgtaccggcgacctggcacggcgtcgcagcgatggg
gtgctggagtatgtcgggcgtatcgaccaccaggtgaagattcgcggctaccgcatcgaa
ctgggtgaaatcgaagcgcgcctgcacgaacaacctgacatccgcgacgcggcggtcggg
gttcaggagggcgtcaatggtaagcatctggttggctacctggtggcggccgatgcaaca
ttgaacactggcgagcgcctggagcgcatcaagcaacgcctgcgtgccgaactgcccgaa
tacatggtgccgctgcattggctatggcttgaccgcctgcccctgaatgccaacggtaaa
ctcgaccgcaaggccctgccggccctggagattggtcagttgcacagccaggactatgtg
acgcctcgcactgaactggaagccacgttggcggctatctgggctgaggtgctgagggtc
gaacgggtcggggtgcgggacaacttcttcgaactgggcgggcactcgctgctggctacg
cagatcgcttcacgggtgcagaaaacgttgcagcgcgacgtgccgctgcgggcgatgttc
gagtgcagcacggtggcggagctggcggagtatatcgacgggttggcggccaatgagatc
agtgccgagaaggtggatcggttgagtgatttgatggcggagttggaggggttgtaa

DBGET integrated database retrieval system