KEGG   Pseudomonas fluorescens F113: PSF113_1750Help
Entry
PSF113_1750       CDS       T01734                                 

Gene name
pvdL
Definition
(GenBank) PvdL
Organism
pfe  Pseudomonas fluorescens F113
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2028048..2041076
Genome map
AA seq 4342 aa AA seqDB search
MGDNLQAESRQETPMTDAFELPSTLAHALQRRAALTPDRVALRFLADTPEQGVVLSYRDL
DLRARTIAGALQAEAALGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARRHHQE
RLLSIITDAEPRLLLTSSDLREPLQAIESAPPVLCVDTLDPARAGQWRMPTLQDDDIAFL
QYTSGSTALPKGVQVSHGNLVANELLIRHGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQP
VFSGVPCVLMSPAYFLARPLRWLEAISEYGGTISGGPDFAYRLCSERVSDSALQRLDLSG
WRVAYSGSEPIRLDTLERFAEKFAPCGFTPDNFMASYGLAEATLFVAGTPRRHGIPSLRV
DDAALAQNRAEPGPGSAVMSCGVSQPGHAVLVVEPATVQPLADNQVGEVWAAGPSIALGY
WRNPEASAKTFVQHDGRTWLRTGDLGFLRDGELFITGRLKDLLIVRGHNLYPQDIEQTIE
REVEVVRKGRVAAFAVNDNGEEGIGIAAEISRSVQKILPPEALIKAIRQAVAEACQQAPS
VVVLLNPGALPKTSSGKLQRSACRSRLADGSLDSYAQFPSAEAEGADESAPSSELQTLIG
QIWREQLQVEQIQADDHFFLLGGNSIAATQVIARLRESLGLELNLRLLFEAPTLVAFAAA
VANQQQDGGQPQGAISALSRDDALPQSLAQNRLWITWQLDPASHAYNIPGALHLRGELDE
DALRASFQQLIERHESLRTRFLERDGVALQQVDPAGEFKLRVIDLGDLPADSREARARQV
REDEAATPFDLEKGPLLRVSLLRLDEDDHQLLVTLHHIIADGWSMNVLVEEFSRLYAAAS
QGQVAGLASLPLQYADYGSWQRQWLAQGEAEHQLSYWKQQLGAEQSVLVLGTDHPRSAQR
QRSAARHSLRLDKGLGEALRHVAQAHDATSFMLLLAAFQALLQRYTGQSDLRIGVPNANR
PRLETQGLIGFFINTQVLRGQVDSRQPFAALLAQAREATLGAQAHQDLPFEQLLEAFPEA
REQGLFQVMFNHQQRDLSALRRLPGLLAEELPWHSREAKFDLQLHSEEDRNGRLTLSFDY
ADELFEAATIERLAAHYCNLLRAVCADPQQVIGDVPLLGADEHAQQLQWSAAPCAPASQW
LPELLNEQARCTPQRTALRWDGGQLDYAELHTQANRLAHYLRDKGVGPDVCVAIAAERSP
QLLIGVLAIIKAGGAYVPLDADYPAERLAYMLHDSGVDLLLTQTALLERLPACDGVSVIA
MDALHLEQWPSNPPGLHLHGDHLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYGLD
ATDVLMQKAPISFDVSVWECFWPLITGSELVLAGPGEHRDPHRIAQLVQQFGVTTLHFVP
PLLSLFVDEPLSAHCISLRRLFSGGEALPAELRNRVLAQLPSAQLHNRYGPTETAINVTH
WHCTEADGERSPIGRPLGNVLCRVLDSELNPVPAGVPGELCIGGLGLARGYLGRPGLSAE
RFVADPLGPAGARLYRTGDRARWNADGVIEYLGRLDQQVKLRGFRVEPQEIEARLLAQAG
VAQVAVLVRDTSAGPQLIGYYTAPEVAHGQDELNTRLKAALAAELPDYMVPAQLLRLDAM
PLGPSGKLDRRALPEPQWQVREHVEPASALEQQIAGIWRDVLGLACIGLRDDFFALGGHS
LLATQIISRTRQTCDVELPLRTLFEASELGAFAEQVRLIQVSGQTNRQPPIEKVDRSQPV
PLSYSQQRMWFLWQMEPDSPAYNVGGMARLRGVLDVGRFEAALEALILRHETLRTTFPSV
DGVARQQVHSETGLRMGWKDFSMLAADMRQQRVQQLADSEAHQPFDLETGPLLRACLVKT
AEHEHYFVLTLHHIVTEGWAMDIFARELSALYEAFIDDRESPLEPLPVQYLDYSVWQRQW
LESGERQRQLDYWTAQLGREHPLLELPGDRPRPSVQSHRGELFRFDLSDDLAARVRAFNA
QQGLTLFMTMTAALAVLLYRYSGQTDLRIGAPVANRIRPESEGLIGAFLNTQVLRCQLDG
QMSVGELFEQVRHTVIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSR
TLAGMTVEYLVNDARATKFDLNLEVTDLDQRLGCCLTYSTDLFDEPRIARMAGHWRNLLE
ALLVDPARRLSELPLLDTREQQQLLDSLGVEPGEHRLDQCLHALFDEQARMRPDAPALTF
AGQTLTYAQLDSRANRLAWMLRERGVGPQVRVGLALERSLEMVIGLLAILKAGGAYVPLD
PEYPLDRLSYMIEDSGVSLLLSDRAMFQALGALPEGVGCWCLEDDSAALAQYPDHSLPLI
NLPQHQAYLIYTSGSTGKPKGVVVSHGEIAMHCQAVIQRFGMRPDDCELHFYSINFDAAT
ERLLVPLLSGAQVVLRAQGQWDAEEICGLIRQHRINILGFTPSYGSQLAQWLATQGQTLP
VRMCITGGEALTGEHLQRIRAAFSPSLFFNAYGPTETVVMPLASLAPEQLEEGATSVPIG
SVIGARVAYILDADLALVPQGATGELYVGGAGLAQGYHQRPGMTAERFVADPFATEGGRL
YRTGDLVRQRADGLVEYLGRIDHQVKIRGFRIELGEIETRLLEHEAVREAVVLALDTPGG
KQLVGYLVSDIASQDGEQQATLRDALKNHLKAQLPDYMVPTHLILLANMPLTANGKLDRR
ALPMPDPELNRQHYVAPSNALEQTLAAIWCDVLNVGQVGLNDNFFELGGDSILSIQVVSR
ARQQGIHFTPRDLFQHQTVQTLAAVATRSQQVLAEQGLLQGESGLTPIQHWFFERQIPNQ
HHWNQALVLAPTTALAPQPLEQALRSVFQHHDALRLGFDESTGHWRAEHQPLSDAALLQH
VSVDTAQDCEALFAKTQSRFNLSTGPLLRAVLAQLPDGQQRLLIVIHHLVVDGVSWRVLM
DDLQTVYRQLTTGQEVQLPAKTSPLRDWSARLQAYAGSESLREELQWWQAQLSGAQVQLP
CANPEGGLQERHAETVSVRLDVERTRQLLQQAPSAYRTQVNDLLLTALARVLCRWSGHAS
ALVQLEGHGREALFDDIDLTRTVGWFTSVYPVRLSPVGDDFSASIKAIKEQLRAVPHKGL
GHGVLRYLTEATTRQTMASLPHAAITFNYLGQLDQTLGQDALFQALDAPLGAIHDLDAPL
PNELSVDSQVSGGELVLRWTFSRERHDRQAIATLAEAYLDELQRLIEHCLTDEAGGLTPS
DFPLAKLTQGQLDSLPVPAGQIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSEL
DPQRFAQAWQAVIARHEALRASFCWNVGEDMLQIIHKPGSTPVDYLDWSEVPEDAQEAKL
QALLKNEREAGFDLLNQAPFHLRLIRVDAARYWFMMSNHHILIDAWCRSLLMDDFFEIYT
ALGENREPQLAVPPRYRDYIGWLQHQSLAEARQWWQRNLQGFERTTPIPGDRPFLREHAG
DSGGMIVGDCYTRLDARDGARLRELAQAHQLTVNTFAQAAWALVLRRVSGDRDVLFGVTV
AGRPVELPQMQRTVGLFINSIALRVQMPEDHQRCSVRQWLSDLLDRNMQLREYEYLPLVS
IQEVSELPKGQPLFDSLFVFENAPVEVSVLDRAQSLNATSDSGRTHTNFPLTAVCYPGDD
LGLHLSYDQRYFDESTVQGLLGEFKRLLLALMEGLHGDMSELPLIGAEEQDFLIEGCNQS
EHAYPLEQSYVELFEARVATHPHRPAVRCLDASYSYAELNARSNRLGHALIAAGVGLDQP
VALLAERDAELLGMIIGSFKAGAGYLPLDPGLPSQRLSRIIELSRTPLLVCTQACEAQAQ
ALLDEFACSGRPKLLVWETVQASDFSPQDPGVYSGPDNLAYVIYTSGSTGLPKGVMVEQR
GMLNNQLSKVPYLALSEADVIAQTASQSFDISVWQFLAAPLFGARVDIVPNAIAHDPQGL
LEHVQQQGISVLESVPSLIQGMLAQERIGLDGLRWMLPTGEAMPPELAHQWLLRYPDIGL
VNAYGPAECSDDVAFFRVDKASTRGAYLPIGTPTDNNRLYLLDGALDLVPLGAVGELCVA
GTGVGRGYVSDPLRTAPVFVPNPFGAPGERLYRTGDLARRRSDGVLEYVGRIDHQVKIRG
YRIELGEIEARLHEQPEVRDGAVGVQEGANGKHLVGYLVATDSALKPTERLERIKQRLRA
ELPEYMVPLHWLWLERLPLNANGKLDRKALPALEIGQLQSQDYQAPGNELEQTLADIWAQ
VLKVERVGVRDNFFELGGHSLLATQIASRVQKALQRNVPLRAMFECSTVQELADYIDGLA
ASEITEEKVDRLNDLMAELEGM
NT seq 13029 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacaacttgcaagccgaatccaggcaggaaacccccatgaccgacgcgttcgaa
ctccccagcaccctggctcatgccctccagcgccgcgccgcgttgacgccggaccgggtg
gccctgcgcttccttgccgacaccccggagcagggtgtggtgttgagttatcgcgacctg
gacctgcgcgcccggaccatcgctggcgccttgcaggccgaagcggcgcttggcgatcgc
gccgtgctgctgttccccagcggcccggattacgttgcggcgttctttggctgcctctac
gccggggtgattgccgtgccggcctatccgccggagtctgcccgccgccatcatcaggag
cgcttgctgtcgatcattaccgacgccgagccgcgcctgttgctcaccagcagcgatctg
cgcgagccattgcaagccatcgaatcggcgccgccggtgttgtgtgtcgataccctcgac
ccggcccgcgccgggcaatggcggatgccgacgctgcaggacgatgacattgccttcctg
caatacacctccggctccaccgcgctgcccaagggcgtgcaggtcagccacggcaacctg
gtggccaacgaactgctgatccgtcatggcttcggtatcgacctgaaccccgatgacgtc
atcgtcagctggctgccgctgtaccacgacatggggctgattggcggcttgctgcagccg
gtgttcagcggcgtcccctgcgtattgatgtcgccggcctacttcctggcccggcccctg
cgttggctcgaagcaatcagcgaatacggcggcaccatcagcggtggcccggacttcgcc
tatcggctgtgcagcgaacgggtcagtgactcggccctgcagcgtctcgacctgagcggc
tggcgcgtggcctattccggttccgagccgatccgcctcgacacgctggagcggtttgcc
gagaagttcgccccgtgcggcttcacgccggacaatttcatggcctcctacggcctggcc
gaagcgaccctgttcgtcgccggcacgccacgccgccacggcattccttcgctgcgggtg
gatgatgcggcactggcgcaaaaccgtgccgagccggggccgggcagtgcggtgatgagt
tgtggtgtcagtcagcctgggcacgcggtgctggtcgtcgagcccgccacggtgcagccg
ttggccgacaatcaggtcggtgaagtctgggctgctggcccaagcatcgccctgggttac
tggcgcaaccctgaagccagcgccaagacctttgttcagcacgatggccggacctggctg
cgtaccggtgacctgggtttcctgcgcgacggcgagctgttcatcaccggtcgcctgaaa
gacttgctgatcgtgcgcgggcataacctctatccccaggacatcgagcaaaccatcgag
cgcgaagtggaggtggtccgcaaaggccgcgtggccgcgttcgcggtcaacgataacggc
gaggaaggcatcggcatcgctgcggaaatcagccgcagcgtgcagaaaatcctgccgccc
gaagccttgatcaaagccattcgccaggccgtggccgaggcctgccagcaagccccgagc
gtggtggtgctgctcaatcccggcgcgctgcccaagacctccagcggcaagttgcagcgc
tcggcctgccgcagtcgattggccgacggcagcttggacagttatgcacagttcccgtca
gccgaggcagagggcgctgacgagtctgcaccgtcctccgagctgcaaacgctcatcggc
caaatctggcgcgagcagctgcaggtcgaacaaatccaggctgacgatcatttctttctg
ctgggcggtaattccatcgccgccacccaggtgatcgcacggctacgggaaagcctgggg
ctggaactgaacctgcgcctgctgttcgaagccccgaccctggttgcgttcgccgcagcg
gtggcgaaccagcaacaggacggcggccagcctcaaggcgcgatcagcgcattgtcgcgc
gacgatgcgttgccgcaatccctggcccagaaccgtttgtggatcacctggcagctcgac
ccagcgagccatgcctacaacattcccggcgccttgcacttgcgtggcgagctggacgaa
gacgcgttgcgcgccagtttccagcaactgatcgaacgccatgagtccctgcgcacgcgg
ttcctggagcgggatggcgtggccctgcaacaggttgatccggccggtgaattcaagctg
cgtgtcatcgatctcggcgacctgcctgccgactcgcgcgaagcccgggcgcggcaggtt
cgagaagacgaagcggccacgccgttcgatctggagaaggggccgctgctgcgggtcagc
ctgttgcgtctcgacgaggatgatcatcagttgctggtgacgttgcaccacatcatcgcc
gacggctggtcgatgaacgtgttggtcgaagagttttcccggctgtacgccgctgcatcc
caaggccaggtcgccggtctggcgtcgttgcccttgcaatacgccgactacggcagttgg
cagcgccagtggctcgcccagggcgaggccgagcaccaactgagctactggaagcagcaa
ctgggcgcggaacaatcggtcctggtgctgggcacggatcacccacgcagcgctcaacgc
cagcgcagcgccgcgcggcatagcctgcgcctggacaaggggctcggcgaggccctgcgc
cacgtggcccaggcccatgacgcgacgtcgttcatgctgttgctggcagccttccaggcg
ctgttgcagcgttacaccggccaatccgacctccgcatcggcgtgcccaacgccaaccgt
ccgcgcctggaaacccagggactgatcggcttcttcatcaacacccaagtgctgcgcggg
caggtcgattcacgtcagccattcgctgcgctgctggcccaggcccgggaagccacgctc
ggtgcccaggcccaccaggacttgccgttcgaacaattgctcgaagcgtttcccgaggcg
cgtgaacaaggcctgttccaggtgatgttcaaccaccagcagcgtgacttgagtgccttg
cggcgcctgccggggttgctggctgaggagttgccgtggcacagccgcgaagccaagttc
gacctgcaactgcacagcgaagaagatcgcaacggccgtttgacgctgtcgttcgactac
gccgacgaactgttcgaggcggcgaccattgagcggctggcagcgcattactgcaacctg
ttgcgggcggtctgcgcggatccgcaacaagtcatcggcgatgtgccgttattgggcgcc
gatgaacacgcccaacaattgcagtggagcgcggctccgtgcgcgccagcaagccaatgg
ctgccggagctgttgaacgaacaggcccgctgcacgccgcaacgcactgcgttgcgctgg
gacggtggtcaactcgattatgccgagctgcacacccaggccaatcgcctggcccattac
ctgcgggacaagggcgttggcccggacgtgtgcgtggcgattgccgccgagcgttcgccg
cagctgctcatcggtgtgctggccatcatcaaggccggcggcgcctatgtgccgctggat
gcggactacccggccgaacgcctggcctacatgctccacgacagtggcgtcgacttgctg
ctgacccaaaccgcgctgctcgaacgtttgccggcgtgcgacggcgtcagtgtcatcgcc
atggacgccctgcacctggagcaatggccaagcaatccgccgggcctgcacctgcacggc
gaccacctggcctacgtgatctacacatccggctccaccggccagcctaaaggcgtcggc
aatactcacgcggccctggccgagcgcctgcaatggatgcaagcgacctacgggctggat
gccaccgatgtgctgatgcaaaaagcgccgatcagtttcgacgtgtcggtctgggagtgc
ttctggccgctgatcaccggcagcgaactggtactggccggccccggcgaacaccgtgac
ccgcaccgcatcgcccagttggtgcagcagtttggcgtcaccacgctgcacttcgtgccg
ccgttgctcagcctgtttgtcgatgagccgctgagcgcccactgcatcagcctgcgccgg
ctattttctggtggcgaagccctgccggccgagttacgcaaccgggtgttggcgcaactg
ccttcggcgcaactgcacaaccgctacggcccgaccgaaaccgcgatcaacgtcacccat
tggcattgcaccgaagccgatggtgagcgctcgccgatcggccgtcccctgggcaacgtc
ctgtgccgggtactcgacagcgagctcaatcccgtgccggccggtgtgccgggcgagctg
tgcatcggcggcctgggcctggcccggggttacctcggccgcccgggcctgagcgccgag
cgcttcgtcgccgacccattggggccggccggtgcgcggttataccgcaccggcgaccgc
gcgcgttggaacgctgacggcgtgatcgaatacctcggccgcctcgaccagcaggtcaag
ctgcgcggcttccgggtcgaaccgcaggaaatcgaagcgcgcctgctggcccaggccggc
gtcgcccaagtggcggtgctggtgcgcgacacctcggccggcccgcagttgatcggctat
tacaccgcgcctgaggtcgcccacggccaggacgaactgaacacccggctcaaggccgcc
ctggccgccgagctgccggactacatggtgcccgcccagctgttgcgcctggacgccatg
cccctgggcccgagcggcaaactcgaccgccgcgccttgcctgaaccgcaatggcaggtg
cgcgagcatgtcgagccggccagcgccctggagcagcaaatcgccggcatctggcgtgac
gtgctgggccttgcgtgcatcggcctgcgggacgatttctttgccctcggcggccattcg
ctgctggcgacccagatcatttcccgcacccgccaaacctgtgacgtcgaactgccgctg
cgcactttgttcgaagccagtgagctgggcgccttcgccgaacaagtgcgcttgatccag
gtcagcggccagaccaaccgccagccgcccatcgagaaggtcgaccgcagccaaccagtg
ccgctgtcctattcccagcagcgcatgtggttcctctggcagatggagccggacagcccg
gcctacaacgtcggtggcatggcgcgcttgcgcggggtgctggatgtcgggcgcttcgag
gcggccttggaggcgttgatcctgcgccacgaaaccttgcgcaccacgttcccgagtgtc
gacggcgtcgcccgtcagcaggtgcacagcgagacgggcctgcgcatgggctggaaggac
ttttcgatgctggccgccgacatgcgccagcagcgggtgcaacaactggccgacagcgag
gcccaccagcctttcgacctggaaaccgggccgctgctgcgagcctgcctggtcaagacc
gccgagcatgagcattactttgtcctgacgctgcaccacatcgttaccgaaggttgggcg
atggacatcttcgcccgtgaactgagcgcgctgtacgaagcctttatcgacgaccgtgaa
tccccgctggaaccgttgccggtgcagtacctggactacagcgtctggcagcgtcagtgg
ctggagtctggcgagcgtcagcgacagctcgactactggaccgcacaactgggccgcgaa
catccgctgctggaactgcccggtgaccgtccgcggccatcggtgcaaagtcatcgcggt
gaattgttccgtttcgacctcagcgatgatttggcggcgcgggtccgtgccttcaacgcg
caacagggcctgaccctgttcatgaccatgaccgccgccctggccgtgttgctctatcgc
tacagcggccagaccgacctgcgcatcggcgcgccggtggccaaccgtatccgcccggaa
agcgaagggctgatcggggcgttcctcaacacccaggtgttgcgttgccagctcgacggg
cagatgtcggtgggcgaactgttcgagcaggtccgccacactgtcatcgagggccagtcc
catcaggatttgccgttcgatcatctggtggaagccctgcaaccaccgcgcagtgcggcc
tacaacccgttgttccaggtgatgtgcaacgtgcagcgctgggaattccagcagagccgc
acgttggctggcatgacggttgagtacctggtcaatgacgcccgggccaccaagtttgac
ctcaacctggaagtcaccgatctggatcagcgcctgggttgctgtctgacctacagcacc
gacctgttcgacgaaccgcgcatcgcgcgcatggccgggcactggcgcaatctgctggaa
gcgttgctggtcgatccggcccgacgcctgagcgaactgccgttgctggacacccgcgag
cagcaacagctgctcgacagcctgggcgtcgagcccggtgagcatcgcctggaccaatgc
ctccacgcactgttcgacgaacaggcgcggatgcgtcccgatgcaccggccctgactttc
gccgggcagaccctgacgtatgcgcaactggacagccgcgccaatcgcctggcctggatg
ctgcgtgagcgaggcgtcgggccgcaggtgcgggtcggtctggccctggagcgttcgctg
gaaatggtcatcggcctgctggcgatcctcaaggccggcggcgcctacgtgccgctggac
ccggaatacccgctggaccgcttgagctacatgatcgaggacagcggcgtcagcctgctg
ctcagtgaccgggcgatgttccaggccctcggtgcgttacccgagggcgtgggctgctgg
tgcctggaagatgattcggcggccctggcccagtacccggatcactcgctgccgttgatc
aacctgccgcaacaccaggcgtacctgatctacacttccggctccaccggcaagcccaag
ggcgtggtggtgtcccacggtgaaatcgccatgcattgccaggcggtgatccagcgcttc
ggcatgcgtccagacgactgcgagctgcatttctactccatcaacttcgacgcggccacc
gaacgcctattggtgccgttgctcagtggcgcccaggtggtgctgcgggcccagggtcaa
tgggacgccgaggaaatctgcgggctgattcgccagcatcgcatcaacattcttggcttc
acccccagctacggtagccagttggcgcagtggctggcgacccagggccagaccttgccg
gtgcgcatgtgcatcaccggcggcgaggccctgacgggcgagcatttgcagcgcattcgc
gcggcgttcagcccgagcctgttcttcaacgcctatggtccgaccgaaaccgtggtcatg
ccgctggcgagcctggcccccgagcaattggaggagggcgcgaccagcgtgccgattggc
agcgtgattggcgcccgcgtggcgtacattctcgacgccgacctggcgttggtgccgcaa
ggcgccacgggtgaattgtatgtaggcggcgccggtctggcccagggctatcaccaacgt
ccgggcatgaccgccgagcgtttcgtcgccgacccgttcgccaccgagggcggacggctc
tatcgcaccggcgacctggtgcgccagcgtgccgacggtctggttgagtatctgggacgg
atcgaccatcaggtgaaaatccgtggtttccgcatcgagctgggagaaatcgaaacccgt
ctgctggaacatgaggcggtgcgcgaggccgtggtactggccctcgacacgcctgggggc
aagcaactggtcggctacctggtgagcgacatcgccagccaggacggcgagcaacaagcg
accctgcgcgacgccttgaaaaaccacctcaaggcccaactgccggactatatggtgccc
acgcacctgatcctgctggcgaacatgcctttgaccgccaacggcaagctcgatcgccgc
gccttgccgatgcccgatcccgaactcaatcgccaacactacgtggcgccgagcaatgcc
ctggagcagaccctggcggcgatctggtgcgacgtgctgaacgtcgggcaagtgggcctt
aacgataacttcttcgagctgggtggcgactcgatcctgtccatccaggtggtcagccgc
gcccggcagcagggcattcacttcacgccccgggacttgttccagcaccagaccgtgcag
accctggccgcggttgccacgcgcagccagcaggtgcttgccgagcagggcctgttgcag
ggcgagtccgggctgacgccgatccagcattggttcttcgagcgccagatccccaaccag
caccactggaaccaggcgctggtgctggcgccgaccacggccctggcgccgcaaccgctg
gaacaggcactgcgaagcgtcttccagcaccacgatgccttgcgcctgggcttcgacgaa
agcaccgggcactggcgggccgagcaccagccgttgtctgacgcggcgctgttgcagcac
gtgtccgtggacaccgcgcaggattgcgaagcgttgtttgccaagacgcagagccgtttc
aatctatcaaccgggccattgctgcgcgcagtgctggcgcagttacccgatggccagcaa
cggttgctgatcgtcatccatcacttggtggtcgacggtgtgtcgtggcgggtgctgatg
gacgatttgcaaaccgtctaccgccagctcaccaccgggcaggaagtacaactgccggct
aagaccagcccattgcgggactggtccgcgcgcttgcaggcttacgccggcagcgaatcc
ctgcgcgaagaactgcagtggtggcaagcgcagttgagtggcgcgcaggtgcaactgccg
tgcgcgaatcccgagggcgggctgcaggagcgtcatgctgaaactgtcagcgtgcgcctg
gacgtcgagcgcacccggcaactgttgcaacaggcgccgagcgcctatcgcacccaggtc
aacgacctgctgcttaccgcgctggcccgggtactgtgccgttggagcggccatgcctcg
gccctggtccagcttgaaggccacggccgcgaagcgctgttcgacgacatcgacctgacc
cgcaccgtcggttggttcaccagcgtctaccccgtgcgcttgagtccagtgggtgacgac
ttcagcgcgtcgatcaaggccatcaaggaacaactgcgcgcggtgccccacaaggggctc
ggccatggcgtattgcgctacctgacggaggcgacgactcgccagacgatggccagcctg
ccgcacgcggcgatcaccttcaactacctgggccagctcgaccagaccctgggtcaggat
gcattgttccaggcgctggatgcgccgttgggggcgatccacgatctcgatgcgccgctg
cccaatgagctgagcgtcgacagccaggtcagcggtggcgaactggtgctgcgctggacg
ttcagccgtgaacgtcatgatcgtcaggctatcgccaccctggccgaggcctacctcgat
gagttgcaacgcctgatcgagcactgcctgacggacgaggcgggcgggctgacgccatcg
gacttccccctggcgaagctgacccagggccagctcgacagcctgccggtgccggccggg
cagatcgaagacgtctacccgctgacgcccatgcaggaaggcatgctgttgcataccttg
ctggaaccgggcaccggcttgtactacatgcaggaccgctatcgcatcaacagcgaactg
gacccgcagcgttttgcccaggcctggcaagcggttatcgcccggcatgaagccttgcgc
gcgtcgttctgctggaacgtcggcgaagacatgctgcaaatcatccacaagcccggcagc
accccggtggattacctcgactggtccgaggtgcccgaagacgcccaggaagccaagctc
caggccctgctcaagaacgagcgcgaggccggtttcgatctgttgaaccaggcaccgttc
cacctgcgactgattcgggtcgacgcggcacgctactggttcatgatgagtaaccaccac
atcctcatcgatgcctggtgccgttcgctgctgatggacgacttcttcgagatctacacc
gccctgggtgaaaaccgcgaaccgcagttggccgtgccaccgcgttatcgcgactacatc
ggctggctgcagcaccagagcctggccgaagcccgccagtggtggcagcgcaacctgcaa
ggcttcgagcggaccacgccgatcccgggcgaccggccattcctgcgcgagcacgccggt
gacagcggcggcatgatcgtcggcgactgctacacccgtctcgatgcccgggacggtgca
cggctgcgggaattggcccaggcccatcaactgacggtcaacaccttcgcccaggcggcg
tgggccctggtgctgcggcgggtcagcggcgaccgcgacgtgctgttcggcgtcaccgtg
gccgggcgcccggtggagctgccgcagatgcaacgcaccgtggggctgttcatcaacagc
atcgccttgcgcgtgcagatgcctgaggaccatcagcgttgcagcgtgcgccagtggctc
agcgatttgctggaccgcaacatgcaactgcgcgagtacgaatacctgccgctggtgagc
atccaggaggtcagcgaattgcccaagggccagccgctgttcgacagtttgttcgtgttc
gagaacgcgccggtggaggtctcggtgctggaccgcgcccaaagcctcaacgccacttcg
gactcgggccggacccacaccaacttcccgctgacggcggtctgctatccaggggatgac
ctgggactgcatctttcctacgaccagcgctacttcgatgaaagcaccgtccaaggtctg
ctgggcgagttcaagcggttgctgctggcgttgatggagggcttgcacggcgacatgagc
gagctgccgctgatcggtgccgaagaacaggacttcctcatcgagggctgcaaccagagc
gaacatgcctatccgctggagcagagctacgttgagctgttcgaggcgagggtcgcgacc
catccccaccgccctgcggtcaggtgcctggacgcgagctacagctacgccgagttgaat
gcgcgcagcaaccgcctcggccacgccctgatcgctgccggtgtcggcctggatcagcca
gtggcgctgctggccgaacgggatgccgagttgctgggcatgatcatcggcagcttcaag
gccggtgccggctatctgccgctggatcccggcctgccgagccagcgcctgagccgcatc
atcgaattgagccgcacgccgttgctggtctgcacccaggcctgcgaggcccaggcacag
gcgttgctggatgaattcgcctgttccgggcggccaaagttgctggtgtgggaaaccgtc
caggccagcgacttttcgccgcaagacccaggcgtctacagcggaccggataacctcgcc
tacgtgatctacacctccggctccaccggcctgcccaaaggcgtgatggtggagcagcga
ggcatgctcaataaccaactgagcaaagtgccgtacctggcgctgagcgaggcggatgtg
atcgcccagacggcttcccaaagctttgatatttcggtctggcagttcctggccgcgccg
ttgttcggtgcccgggtcgacatcgtgcccaacgccattgcccacgacccgcaagggctg
ctggagcatgtacagcagcagggcattagcgtgctggaaagcgtgccgtcgctgatccag
ggcatgcttgcccaggaacgcatcggtctggacggcttgcgctggatgctgcccaccggc
gaagcgatgccgccggaactggcgcaccagtggttgttgcgttacccggacattggcctg
gtcaacgcctacggtcctgcggaatgctcggatgacgtggcgttcttccgggtcgacaag
gcgtcgacccgcggcgcttacctgccgattggcacgcccaccgacaacaaccgtctgtac
ctgctcgacggcgcgctggacctggtgccgctgggcgcggtgggtgagttgtgcgtggcc
ggcaccggggtcgggcgcggttatgtcagcgatcccctgcgtactgccccggtctttgtg
ccgaatccgtttggggcgccgggggagcggctgtaccgtaccggcgacctggcgcggcgg
cgcagcgatggagtgttggagtacgtcgggcgcatcgaccatcaggtgaagatccgcggc
taccgcatcgagttgggggaaatcgaagcacgcttgcatgaacagccggaagtgcgcgac
ggggcggtgggtgtgcaggagggcgccaatggcaagcatctggtgggctacctcgtggcc
accgactcggcgctcaaacccaccgagcgcctggagcgcatcaagcagcgcctgcgggcc
gaactgccggaatacatggtgccgctgcactggctgtggctcgagcgcctgcctctcaac
gccaacggcaagctcgaccgcaaggccttgccggccctggagatcggccagttgcaaagc
caggactaccaggctcccggcaatgaactggaacagaccctggcagacatctgggcccag
gtgctgaaagtcgagcgggtgggggtgcgggacaacttcttcgaactgggcgggcattcc
ttgctggcgacgcaaatcgcctcacgggtgcaaaaggccctacaacgcaacgtgccgctg
cgggcgatgttcgaatgcagcacggtgcaggaactggccgactacatcgatgggctggcg
gccagcgaaatcaccgaggagaaggtggatcggttgaatgatttgatggcggagttggaa
ggcatgtag

DBGET integrated database retrieval system