KEGG   Pseudomonas fluorescens PICF7: PFLUOLIPICF716790Help
Entry
PFLUOLIPICF716790 CDS       T03767                                 

Definition
(GenBank) peptide synthase
Organism
pff  Pseudomonas fluorescens PICF7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3621330..3634211
Genome map
AA seq 4293 aa AA seqDB search
MMDAFELPPTLVQSLQRRAAQTPDQVALRFLAESAEHSVVLSYRDLDQRARTIAAALQAN
ADLGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESTRRHHQARLLSIISDAEPRLL
LTIASLADGLSQLENAPPVLSVDRLEGAGNWVAPDLHPDDIAFLQYTSGSTALPKGVQVS
HGNLVANEVLIRRGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLMSPAYFL
GRPLRWLEAISEYGGTISGGPDFAYRLCSERVSETALERLDLSRWRVAYSGSEPIRLDTL
ERFAEKFAACGFTPNHFFASYGLAEATLFVAGGSRGQGIAAMRVDDQALAANRAEPGQGS
AIMSCGTRQPEHAVLIADPHTLAELPDNHVGELWATGPSIAHGYWRNPEATAKTFVQHAG
RRWLRTGDLGFIRDGEVYITGRLKDLLIVRGHNLYPQDIEQTIEREVEVVRKGRVAAFAV
NEQGLEGIGIAAEISRSVQKILAPEALIKAIRQAVAEAYQEAPSVVVLLNPGALPKTSSG
KLQRAACGLRHKDGSLDSYAQFPNLHAQEGDGALESELHNQIAAIWCEQLQVATVAADDH
FFLLGGNSITATQVVARLRERLGLELNLRMLFEAPTLEGFAASVAQLQQDGGVAQGAIHS
LSRQEELPQSLAQNRLWITWQLDPHSSAYTIPGALRLRGELDEDAVRTSFQQLIQRHEAL
RTRFYERDGQAFQRVDTKADFDLQVIDLSDLPVAEREARAQQIREDEARTQFDLEKGPLL
WVTLVRLDDEDHQLLVTLHHIIADGWSLNILMDEFSRLYAAAVQGQTLELPPLALQYADY
GTWQRQWLAEGEGQRQLAYWKAQLGEEHPTLSLATDHPRSAHHRHSASRHTVRLGASLSE
AIRQTARTHESTPFMLLLAAFQSVLYRYSGQRDIRIGVPNANRPRQETQGLVGFFINTLV
LRAELDGRLPFTELLAATRQAALGAQAHQDLPFEQLLEAFPQAREQGLFQVIFNHQQRDL
SALRRLPGMLADELPWHSREAKFDLQLHTEEDRNGRLSLSFDYADELFESATIQRLAEHY
INLLHAVCEQPRQAIGDLMLMQHDEQALYSEAPCAPAQVWLPELLNQQTSDTTALVWGGG
SLTFAQLHTQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLAIIKAGGAYVPLDPDY
PTERLAYMLKDSGVHLLLTQTALLEQVPAACGVCVIAMDSLHLDSWPTQPPGLHLHGDNL
AYVIYTSGSTGQPKGVGITHAALAERLQWMQATYPLNETDVLMQKAPISFDVSVWECFWP
LITGCRLVLAGPGEHRDPHRIAQLVQEHGVTTLHFVPPLLQLFIDEPLVAECTSLRRLFS
GGEALPAELRNRVLAQLPAVQLHNRYGPTETAINVTHWHCRAEDGERSPIGRPLGNVICR
VLDEQLNPVPLGVPGELCIGGIGLARGYLGRAGLTAERFVADHQGARLYRTGDRARWSAD
GVIEYLGRLDQQVKLRGFRVEPEEIEARMLALEGIAQAVVLVRDGQLIGYFTAHGDLDEQ
QVKTALAAELPEYMVPALLMPLDAMPLSPSGKLDRRALPAPVWQVREHVEPETPLQQQIA
AIWREVLGLPSIGLRDDFFALGGHSLLATQIISRTRQACDVELPLRTLFDASELGAFAEQ
VGLIQASGQRNQQTVIAKVDRGQPVPLSYSQQRMWFLWQMEPDSPAYNVGGMARLRGVLD
VGRFEAALQALIMRHETLRTTFPSVDGVAYQNVSPQTGLRMDWQDFSALSEADRQPRLQR
LADHEAHTPFNLETGPLLRACLVKAGEQEHYLVLTLHHIVTEGWAMDIFARELSALYEAF
IDERDSPLAPLPVQYLDYSVWQRQWLESGERQRQLDYWTAQLGNEHPLLELPGDRPRPPV
QSHQGELYRFDLSDDLAARVRAFNAERGLTLFMTMTATLAVLLYRYSGQTDLRIGAPVAN
RIRPESEGLIGAFLNTQVLRCQLNGQMNVAELFEHVRHTVIEGQSHQDLPFDHLVEALQP
PRSAAYNPLFQVMCNVQRWEFQQSRQLAGMTVEYLANDARATKFDLNLEVTDLDHRLGCC
LTYSTDLFDEPRIARMAAHWRNLLEALIADPQQRLSELPLLGADEQRVLQDSLGIENGEH
RLDQCIHPLFSQQVAARGDAPALTFAGVTLSYRELDARANRLAWMLRERGVGPQVRVGLA
LPRSLEMVIGLLAILKAGGAYVPLDPEYPLDRLHYMIEDSGIGLLLSDAAMFEALGELPA
TVACWCLEDDLPVLANYPADALPFISLPQHQAYLIYTSGSTGKPKGVVVSHGEIAMHCAA
VIERFGMRADDCELHFYSINFDAATERLLVPLLSGAQVVLRAQGQWDAEEICGLIRTHGI
NILGFTPSYGSQLAQWLATRQQTMPVRMCITGGEALTGEHLQRIRAAFQPQVFFNAYGPT
ETVVMPLASLAPEHLEEGAASVPIGSIIGDRVAYILDADLALVPQGATGELYVGGAGLAQ
GYHQRPGMTAERFVADPFARNGGRLYRTGDLVRQRVDGLVEYLGRIDHQVKIRGFRIELG
EIETRLLEHDAVREAVVLALDAPSGKQLVAYLVSDAEHVALRDALKAHLKAHLPDYMVPA
HLIVLDSMPLTANGKLDRRALPQPDPEANRQHYVAPRNELESTLAAIWCAVLNVQQVGLD
DNFFELGGDSILSIQVVSRARQAGIHFSPRDLFQHQTVQTLAAVATRSEQVTAEQGLLTG
SSGLTPIQHWFFDTETPNRQHWNQALVLKPLQLLDPQRLEQALLAVLEHHDALRLSFSKR
DAQWHAEHRAVPQGGVLMQAQVRDMAHCTALFTDTQRSLDLEHGPLLRALLVDGPEGQQR
LLIAIHHLVVDGVSWRVLLEDLQTVYRQLNDGQSVSLPAKTSALRDWAARLQAYAGSESL
REELSVWQHQLAGPDAALPVARPQGSLRNRDADTVSVRLDAEHTRQLLQQAPSAYRTQVN
DLLLTALARVLCRWSGHACALIQLEGHGRETLFDDIDLTRSVGWFTSAYPLRLTPQTGQG
DSIKAIKEQLRAVPHKGLGYGVLRYLADDLCKQTLAALPSAQITFNYLGQFDQSFGADAL
FHPLDESAGLAHDPDAPLPNELSVDSQVYGGELVLRWTFSRERHDQQSIHELADAYLTEL
QSLVAHCLEDDAGGLTPSDFPLAHLTQAQLDSLPIAASAIEDVYPLTPMQEGLLLHTLLE
PGTGLYYMQDRYRINSALDPERFAQAWQAVIARHEALRASFCWNVGEDMLQVIHTPGSTP
IEYLDWSDDPEDQQEPRLQALLKQEREAGFDLLNQAPFHLRLIRVGAERYWFMMSNHHIL
IDAWCRSLLMNDFFELYMALGEGRDAQLATPPRYRDYIAWLQRQNLNEARQWWQQNLQGF
ERTTPIPSDRPFLREHAGHSGGMVVGDCYTRLDARDGAQLRELAQAHQLTVNTFAQAAWA
LVLRRLSGDRDVLFGVTVAGRPVEMPEMQRTVGLFINSIALRVKLPEDGQACSVRQWLSG
LLDSNMQLREYEYLPLVTIQEHSELPKGQPLFDSLFVFENAPVEVSVLDRAQSLNATSDS
GRTHTNFPLTAVCYPGDDLGLHLSYDQRYFDETTVQGMLGEFKRLLLALVQGFQGDMADL
PLIGEQEREFLVEGCNQSEHDYPLERSYIELFEEQVAAHPQRIAASCLDQQWTYDELNRR
SNGLGHALMAAGVGLDQPVALLAERNLDLLGMIIGSFKAGAGYLPLDPGLPSQRLRSILD
LSRTPLLVCTEASREQAIELLDGFDCQLLVWEEIPARGENPGVYSAPDNLAYVIYTSGST
GLPKGVMVEQRGMLNNQLSKVPYLALSDADVIAQTASQSFDISVWQFLAAPLFGARVDIV
PNTIAHDPQGLLEHVQAQGITVLESVPSLIQGMLAQDRIGLDGLRWMLPTGEAMPPELAH
QWLQRYPEIGLVNAYGPAECSDDVAFYRVDLASTRGTYLPIGTPTDNNRLYLLDGALELV
PQGAVGELCVAGTGVGRGYVSDPLRTAPVFVPNPFGAPGERLYRTGDLARRRSDGVLEYV
GRVDHQVKIRGYRIELGEIEARLHEQPEVRDAAVGVQEGVNGKHLVGYLVAADEALNPSE
RLDRIKQRLRAELPEYMVPLHWLWLDRLPLNANGKLDRKALPALEIGQLQSQDYLAPRNE
LEATLAAIWAEVLKVERVGVQDNFFELGGHSLLATQIASRVQKTLQRDVPLRAMFECSTV
AELAEYIDGLAANEVSAEKVDRLSDLMAELEGL
NT seq 12882 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgccttcgaacttccccctaccctggtccagtcccttcaacgtcgcgctgcg
cagaccccggaccaggtcgccttgcgcttcctcgccgagtccgccgagcacagcgttgtg
ctcagttatcgcgatctggatcagcgtgcccgcaccatcgccgccgccttgcaggccaat
gcggacctgggcgaccgtgccgtgctgttgttccccagtggcccggattatgtcgcggcg
ttctttggttgcctgtacgcgggtgtgatcgcggtgccggcctatccgccggagtccacc
cgtcgccaccatcaggcgcgactgctgtcgatcatcagcgatgccgaaccgcgtctgctg
ctgaccatcgccagcctcgccgatggcttgtcgcagctcgaaaatgcgccgcccgtattg
agcgtcgatcggctggaaggtgccggcaattgggtcgcccctgacctgcatccggacgac
atcgccttcctgcaatacacctctggttccaccgcgttgcccaagggcgtgcaagtcagc
cacggtaacctggtggccaacgaagtgttgatccgtcgcggtttcggcatcgacctgaac
cccgatgacgtgatcgtcagttggctgccgctgtaccacgacatggggctgattggcggt
ttgctgcaaccgatcttcagtggtgtgccctgcgtgctgatgtcgccggcctacttcctc
gggcgaccgttacgttggctggaagcgatcagtgaatacggcggcaccatcagcggcggt
ccggacttcgcctatcgcctgtgcagcgaaagggtcagcgagaccgcgttggagcgcctg
gatttgagccggtggcgcgtggcctattccggctccgagccgatccgcctcgacaccctg
gaacgcttcgccgagaagttcgccgcctgcggttttaccccgaaccatttctttgcctcc
tacggcctggccgaggcgaccctgtttgtcgcgggcggcagccgtggccagggcattgcg
gcgatgcgcgtcgacgatcaggccctggccgccaatcgcgccgagccggggcagggcagt
gcgatcatgagctgtggcacccgccagccggaacacgcggtgctgatcgctgacccgcat
acccttgccgagctgcccgacaaccacgtcggcgaactctgggccacgggtccgagcatc
gcccacggctactggcgtaaccccgaagccaccgccaagacctttgtgcaacatgccggc
cgtaggtggctgcgtacgggcgacctgggcttcatccgtgacggtgaggtgtacatcacc
ggtcgcctcaaagacctgctgatcgtgcgcggccacaacctgtacccacaagacatcgag
cagaccatcgagcgcgaagtggaggtggtacgcaaaggccgggtcgccgcatttgcagtg
aatgagcagggcctggaaggcatcggcattgccgctgaaatcagccgcagtgtgcagaaa
atcctggcgcccgaggcgctgatcaaggcgattcgccaagccgtcgccgaggcgtatcaa
gaggcgccaagcgtggtggtgctgctcaaccctggcgccttgccgaagacctccagcggc
aagctgcagcgcgcggcctgtgggcttcgtcacaaggacggtagcctcgacagctatgcg
cagttcccgaacctgcacgcgcaggagggcgatggggcgctggaatccgaactgcacaac
cagattgcggcgatctggtgcgagcagttgcaggtggcgacggttgcggccgatgaccac
ttcttcttactcggcggcaactccatcaccgccacccaggtggtcgcacgcctgcgcgaa
cgcctcggcctggagcttaacctgcgcatgctgttcgaagcaccgaccctggaaggcttt
gccgccagcgttgcgcagttgcagcaggacggcggcgtcgcccaaggcgcgatccacagc
ctgtcgcgccaagaggaattgccccaatccctggcacagaaccgcctgtggatcacctgg
caactggacccccacagcagcgcctacaccatccccggcgccctgcgcctgcgcggcgag
ctggatgaagacgcggtgcgtaccagcttccagcaactgatccagcgccacgaagccctg
cgtacacgcttctacgagcgcgacggccaggctttccagcgtgtcgataccaaggccgat
ttcgacctgcaagtcatcgacctcagcgacctgcccgttgccgagcgcgaagcccgtgca
caacagatccgcgaagacgaagcgcgcacccagttcgacctggaaaaaggcccgctgttg
tgggtgaccctggtgcgtctggacgatgaagatcaccaactgctggtgacgctgcaccac
atcatcgccgacggctggtcgctcaatatcctgatggacgagttctcacgcctctatgcc
gccgcagtccagggccagaccctggagctgccgcccctggccctgcaatacgccgactac
ggcacttggcagcgccaatggctggccgaaggtgaaggccagcgtcaactggcgtactgg
aaagcgcagttgggtgaagagcatcccaccctgagcctggcgaccgaccacccgcgctcc
gcacaccatcgtcacagtgcctcacgccacactgtgcgccttggcgcgagcctcagcgaa
gccattcgccagaccgcccggacccacgagtccaccccgttcatgctgttgctggcagcc
ttccagagcgtgctctaccgttacagcggccaacgcgatatccgcatcggcgtgcccaac
gccaaccgcccgcgccaggaaacccaaggcctggtcggcttcttcatcaacaccttggtg
ctgcgtgccgagctggatggacgcctgcccttcactgaactgttggccgcgacacgccag
gctgcgctgggcgcccaggcccatcaggatttgccattcgaacaactgctggaggccttc
ccgcaggcccgcgagcagggcctgttccaggtcatattcaaccaccagcaacgcgacctc
agcgccttgcgccgcctgccgggcatgctcgccgacgagttgccgtggcacagccgcgaa
gccaagttcgatttgcaactgcacaccgaagaagaccgcaacgggcgcctgagcctgtcg
ttcgactatgccgatgaactgttcgaaagcgcgaccatccagcgcctcgccgagcactac
atcaacctgttgcacgccgtctgcgaacaaccccggcaagccatcggcgacctcatgctg
atgcagcacgacgaacaagccctttacagcgaagcaccctgcgcaccggcccaagtgtgg
ctgcccgaactgctcaaccagcagacctcggacaccaccgcgctggtctggggcggcggc
agcctgaccttcgcccaattgcacacccaggccaaccgcctggcccattacctgcgtgac
aaaggcgtcggcccggacgtgtgcgtggccatcgccgccgaacgttcgccgcaactgttg
atcggcttgctggcgatcatcaaggccgggggcgcttacgtgccgctggacccggattac
cccaccgagcgcctggcctacatgctcaaggacagcggcgttcacctgctgctgacccag
accgcgctgctggagcaggtgccggctgcctgcggcgtgtgcgtcatcgccatggacagc
ctgcacctggacagttggcccacccagccgcccggcctgcatttgcacggtgataacctc
gcctacgtgatctacacctccggttccaccggccagcccaaaggcgtgggcatcacccat
gccgcgctggccgagcgcttgcagtggatgcaggccacttatccactcaacgaaaccgac
gtgctgatgcagaaggccccgatcagtttcgacgtgtcggtgtgggaatgcttctggccg
ctgatcactgggtgccgcctggtactggccgggcccggtgagcatcgcgacccgcatcgg
atcgcgcagttggtgcaggaacacggcgtgaccacgctgcacttcgtgccgccgctgttg
cagttgtttatcgacgaaccgctggtggccgaatgcaccagcctgcggcgcttgttctcg
ggcggggaagccttgcccgccgaactgcgcaaccgcgttctggcccagttgccagccgtg
caattgcataaccgttatggcccgaccgaaaccgcgatcaacgtgacccactggcactgt
cgcgcagaagacggcgagcgctcgccgattggtcggccactgggcaacgtgatctgccgc
gtgctggatgagcagctcaaccccgtgccgctgggcgtgccgggtgagctgtgcatcggc
ggtatcggcctggcccggggttaccttggccgtgccgggttgacggctgagcgttttgtc
gccgatcaccaaggcgcccgcctgtaccgcaccggtgaccgcgcccgttggagcgccgac
ggtgtgatcgagtacctcgggcgtctcgaccagcaggtcaagctgcgcggcttccgtgtg
gagccggaagaaatcgaggcgcgcatgctcgccctggagggcatcgctcaagctgtggtg
ctggtgcgtgacgggcagttgattggctacttcaccgcccatggcgacctggacgaacaa
caggtcaaaaccgccctggccgcggagttgccggaatacatggtgcccgcgctgctgatg
cctctggacgccatgccgttgagccccagcggcaagctggaccgccgcgcgttgccggcg
ccggtgtggcaagtgcgtgaacacgtcgaacccgaaacgccgctgcaacagcaaatcgcc
gcgatctggcgcgaagttctcggtctgccaagcattggtctgcgcgatgacttcttcgcc
ctcggcggccactcgttgctggccacgcagatcatttcccgcacccgccaggcctgtgat
gtggaactgccgttgcgcaccttgttcgacgccagtgaactgggggcgtttgccgagcag
gtcggcctgatccaggcctcgggccaacgcaaccaacagaccgtcatcgccaaggtcgac
cgcggccaacccgtgccgctgtcctattcccagcagcgcatgtggttcctgtggcagatg
gaaccggacagcccggcctacaacgtcggcgggatggcgcgtttgcgtggcgtgctggac
gtggggcgtttcgaggcggcgctgcaagcgctgatcatgcgtcacgaaaccctgcgcacg
acgtttccgagcgtcgatggtgtggcttatcagaacgtttcgccgcagaccgggctgcgc
atggattggcaggatttctccgcgctgagcgaagccgaccgtcaaccgcgcctgcagcga
ctggctgatcatgaggcacacacgccgttcaacctggaaaccgggccgttgttgcgtgcg
tgcctggtcaaggccggcgagcaggaacactacctggtgctgaccctgcaccatatcgtc
accgaaggctgggccatggacatctttgcccgtgaactcagcgcgttgtacgaggccttt
atcgacgagcgcgactcgccgctggcgccgctgcccgtgcaatacctcgactacagcgtg
tggcagcgtcagtggctggagtccggcgagcgccagcgtcagctggattactggactgcg
caactgggcaatgaacacccgctgctggaactgcccggcgaccgtccacgcccgcctgtg
caaagccaccagggcgagttgtaccgcttcgacctcagcgacgacctcgctgcccgcgtg
cgtgccttcaatgccgagcgcggcctgaccctgttcatgaccatgaccgccaccctggcc
gtgctgctctaccgttatagcggccagaccgacttgcgtatcggcgccccggttgccaac
cgtatccgtcctgaaagcgaaggcttgattggtgccttcctcaacacccaggtgctgcgg
tgccagctcaatgggcagatgaatgtcgctgagttgttcgagcacgtgcgccacaccgtg
atcgagggtcagtcccatcaagacctgccgttcgatcacctggtggaggccctgcaaccc
ccgcgcagcgcggcgtacaacccgctgttccaggtgatgtgcaacgtgcagcgctgggaa
ttccaacagagccgccaactggccggcatgaccgtcgaatacctggccaacgatgcgcgg
gcgaccaagttcgacctcaacctggaagtcaccgacctcgaccatcgcctgggttgctgc
ctgacctacagcactgacctgttcgacgagccacgcattgcgcgcatggccgcccattgg
cgcaatctgctggaagccttgatcgcggatccgcagcaacgcctcagcgaattgccgttg
ctcggtgcggatgaacagcgtgtgttgcaagacagcctgggcattgagaatggcgagcac
cgtctcgatcagtgcatccacccactgttcagccagcaggtggcagcccgtggcgatgcg
ccggcgctgacctttgccggcgtgaccctcagctaccgagaactcgacgcccgcgccaac
cgcctggcctggatgctgcgcgaacgtggcgtcggcccgcaggtgcgtgtcggcctggcg
ttgccgcgctccctggaaatggtcatcggcctgctggcgatcctcaaggccggcggtgcc
tatgtgccgctggacccggaatacccgctggaccgcctgcactacatgatcgaagacagc
ggcatcggcctgctgctcagcgatgcggcgatgttcgaggccctcggcgagttaccggcc
actgttgcgtgctggtgtctggaggatgacttgccggtgctggccaactacccggccgat
gcgctgccgtttatcagcctgccgcaacaccaggcgtacttgatctacacctccggctcc
accggcaagccgaaaggcgtggtggtatcccacggtgaaatcgccatgcattgcgcggcg
gtgatcgagcggtttggcatgcgcgcggatgactgcgagctgcacttctattcgatcaac
ttcgatgcggccaccgagcgtctgctggtgccgctgctcagtggcgcacaggtggtgttg
cgggctcaggggcagtgggatgccgaggaaatctgcggattgatccgcacccatggcatc
aacatcctgggcttcaccccgagctacggcagccagttggcgcagtggttggcgacccgg
cagcagaccatgccggtgcgtatgtgcattaccggcggcgaagccctcaccggcgaacac
ttgcagcgcatccgtgccgcgttccagccccaggtgttcttcaacgcctatggcccgact
gaaaccgtagtgatgccgctggccagcctggcgcccgagcacttggaggagggcgccgcc
agcgtgccgatcggcagcatcatcggtgaccgcgtggcttatattctcgacgccgacctg
gccttggtgccgcaaggcgcgaccggcgagttatacgtgggcggtgcgggtctggcgcag
gggtatcaccagcgtccgggcatgaccgccgaacgttttgtcgcggacccgtttgcgcgc
aacggcgggcgcctgtaccgcaccggtgacctcgtgcgccagcgcgtcgatggcttggtg
gagtacctcgggcggatcgaccatcaggtgaagattcgcggtttccgcatcgaactgggc
gagatcgaaacccgcctgctggagcatgacgccgtgcgcgaagcggtggtgctggcgctg
gatgcgccgagcggcaaacagttggtggcgtatctggtcagcgatgccgagcacgtcgcg
ctgcgtgatgcgctgaaggcccatctcaaggcgcacctgccggactacatggtgcccgcg
cacctgatcgtgctggacagcatgccgctgaccgccaacggcaagctcgaccgccgtgcc
ttgccgcagccggatcccgaagccaaccgccaacactacgtggcaccccgcaacgaactg
gaaagcaccctggcggcgatctggtgcgcggtgctgaacgtgcaacaagtcggcctggac
gataacttcttcgagctggggggcgactcgatcctgtcgatccaggtggtcagccgcgcg
cggcaggccgggattcatttcagccctcgcgacctgtttcagcaccagaccgtgcagacc
ctggctgctgtggctacgcgctccgagcaggttacggcagagcagggcctgctgaccggc
agttcgggtctcacgccgatccagcattggttcttcgacaccgagaccccgaaccgtcag
cactggaaccaggcgctggtcctcaagccgctgcagttgctcgacccccagcgcctggaa
caagcgctgctggcggtactggaacaccatgacgccttgcgcctgagcttctccaagcgc
gacgcccaatggcacgccgaacacagggccgtgccgcagggcggcgtgctgatgcaggcg
caagtgcgtgacatggcgcactgcaccgcgctgttcaccgacacccaacgcagcctcgac
ctggagcacggcccgctactgcgcgccttgctggtggacgggcccgaggggcagcaacgc
ctgttgatcgcgatccatcacctggtggtggacggcgtgtcgtggcgtgtattgctggaa
gatctacaaacggtttatcgccagttgaacgatggccagtccgtcagcctgccggccaag
accagtgccctgcgtgattgggccgcgcgtttacaggcgtatgccggtagcgaatccttg
cgtgaggaattgagcgtctggcagcaccagttggccggccctgacgccgcattgccggtg
gcccgcccacaagggtcgctgcgcaaccgcgatgccgacaccgtcagcgtgcgcctggat
gccgaacacacccgccagttgctgcagcaagccccaagcgcctaccgcacccaggtcaac
gacctgttgctgaccgccttggcccgcgtgttgtgccgctggagcggtcacgcttgcgcg
ttgatccaactggaaggccacggccgcgaaaccctgttcgatgacatcgacctgacccgc
agcgtcggctggttcaccagtgcctatccgctgcgcctgaccccgcaaaccgggcagggc
gattcgatcaaggcgatcaaggaacaactgcgcgccgtgccgcataaaggcttgggctat
ggcgtgctgcgctacctcgccgatgacctgtgcaagcagaccctggccgcactgccgagc
gcgcagatcaccttcaactacctcggccagttcgaccagagcttcggcgccgatgcgctg
ttccacccgctggatgaatccgccggcctggcccatgacccggacgcgccgctgcccaac
gagttgagcgtcgacagccaggtgtatggtggtgagctggtgctgcgctggaccttcagc
cgcgaacgccacgatcaacagagcatccatgaactggccgatgcctacctcaccgagctg
caaagcctggttgcacattgtctggaggacgacgccggtggtcttacaccgtccgacttc
ccgctggcgcacctgacccaggcgcaactcgacagcttgccgattgccgccagcgccatc
gaagatgtctacccgctgaccccgatgcaggaaggcctgctattgcacaccctgctggag
cccggcaccggcctctactacatgcaggaccgctaccgcatcaacagcgccctggacccc
gagcgtttcgcccaggcttggcaggcggtgatcgcccgccacgaagccctgcgcgcgtcg
ttctgctggaacgtcggcgaagacatgctgcaagtgatccacacacccggcagcacgccg
attgagtacctggactggagcgacgatccggaggaccagcaggagccgcgcctgcaagcg
ctgctcaagcaagagcgcgaagccggcttcgatctgctcaaccaggcaccgttccacctg
cgcctgatccgcgtcggggccgagcgttactggttcatgatgagcaaccaccacatcctt
atcgatgcctggtgccgttcattgctgatgaatgacttcttcgagctctacatggccctc
ggtgaaggccgcgacgcgcaactggccacgccgccgcgctaccgcgactacattgcctgg
ctgcaacgccagaacctcaatgaggcacgccaatggtggcaacagaacctgcaaggcttc
gagcgcaccacgccaatcccgagcgaccggccgttcctgcgtgaacacgcgggccacagc
ggcggcatggtggtgggcgattgctacacccgtctcgatgcccgcgacggtgcacaactg
cgcgaactggcacaggctcaccagctgaccgtcaacaccttcgcccaggcggcgtgggcg
ctggtgctgcgccgtttgagcggcgatcgcgacgtgctgttcggtgtcaccgtggccggg
cgcccggtggaaatgcccgagatgcaacgcaccgtcggcctgttcatcaacagcatcgcc
ctgcgggtgaaactgcccgaggacggtcaagcgtgcagcgtgcgccagtggttgagcggt
ctgctcgacagcaatatgcaactgcgcgagtacgagtacctaccgctggtgacgatccag
gaacacagcgaactgcccaagggccagccgctgttcgacagcctgttcgtgttcgaaaac
gccccggtggaagtctcggtgctggaccgtgcacaaagcctgaacgccacctcggattcc
ggccgcacccacaccaacttcccgctgaccgccgtgtgctatccaggtgatgacctgggg
ctgcacctgtcctacgaccaacgctacttcgacgaaaccaccgtgcaaggcatgctcggc
gagttcaagcgcctgctgctggcgctggtccaaggcttccagggtgacatggccgacctg
ccactgattggcgagcaggagcgtgagttcctggtggaaggttgcaaccagagcgagcac
gactacccgctggagcgcagctacatcgagctgttcgaagagcaggtcgccgctcatccg
cagcgcatcgccgccagttgcctcgaccagcaatggacctatgacgaactgaaccgtcgc
agcaacggcctgggccacgcgctgatggcagcgggtgtcggcctggatcaaccggtggcg
ttgttggccgagcgtaacctcgacctgctcggcatgatcatcggcagcttcaaggccggt
gccggctacctgccgctggacccaggcctgccgagccagcgcctgcgcagcatcctcgac
ttgagccgcacgccattgctggtgtgcaccgaagcatcccgtgagcaagccatcgagttg
ctggacggttttgactgccagcttctggtgtgggaggaaatacccgcgcgtggtgaaaac
cccggtgtctacagcgctccggataaccttgcctacgtgatctatacctccggttccacc
ggtctgcccaagggcgtgatggtggaacagcgcggcatgctcaataaccaactgagcaaa
gtgccgtacctggccttgagcgacgcggatgtgattgcgcaaaccgcgtcgcagagcttt
gatatttccgtatggcagttcctcgctgcgccgctgttcggcgcgcgggtggacatcgtg
ccgaacaccatcgcgcatgatccccaaggcctgctggaacatgtccaggcccagggcatc
accgtgttggaaagcgtgccgtcgttgatccagggcatgcttgcacaagaccgcatcggc
ctggatggcctgcgctggatgctgccgaccggcgaagcgatgccaccggaactggcgcac
cagtggttgcagcgttatccggagatcgggctggtcaacgcttacggcccggcggagtgt
tcggacgatgtggcgttctatcgtgtcgacctggcgtctacccgaggcacctatttgccg
attggtacgcccaccgacaacaaccgtttgtacctgctggatggcgcactggaactggtg
ccgcaaggcgcggtgggtgagttgtgcgtggccggcacgggtgtcggccgcggttacgtc
agcgacccgctgcgcaccgcgcccgtatttgtgccaaaccccttcggcgcaccgggcgaa
cgactctaccgcaccggcgacctcgcgcgccgtcgcagtgacggcgtgctggagtacgtc
ggacgtgtcgaccaccaagtgaagattcgcggctaccgcatcgaactgggtgaaatcgaa
gcgcgcctgcacgaacaaccggaagtgcgcgatgcggcggtgggcgtgcaggaaggcgtg
aatggcaagcacctggtcggctacctggtggcggcggatgaagcactgaacccaagcgaa
cgcctggaccgcatcaagcaacgcctgcgcgccgaactgccggaatacatggtgccgctg
cactggctctggctcgaccgcctgccgctcaacgccaacggtaaactcgaccgcaaggcg
ttgccggcgctggagatcggccagctgcaaagccaggactacctggcaccgcgcaacgaa
ctggaggctacgttggccgccatctgggccgaggtgctgaaagtcgagagggtaggggtg
caggacaacttcttcgaactgggcgggcactcgttgctggccacgcagattgcctcgcgg
gtgcagaagaccctgcaacgtgatgtgccgctacgtgcaatgttcgagtgcagcacggtg
gcggaattggccgagtatatcgacgggctggcagccaatgaggtcagtgccgagaaggta
gatcggttgagtgatttgatggcggagttggaggggttgtga

DBGET integrated database retrieval system