KEGG   Pyrococcus furiosus COM1: PFC_08705Help
Entry
PFC_08705         CDS       T02183                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PFC_08705
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PFC_08705
   00680 Methane metabolism
    PFC_08705
Enzymes [BR:pfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PFC_08705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1576642..1578060)
Genome map
AA seq 472 aa AA seqDB search
MIPRIMSTQHPDNYSIPFFASSPILEGEDEITEAFYAFSVLGADEQMWDFEGKEVDEFVV
KKLLERYPTFFKNNILGKDIRLTPRVPNPSVEKEEAKLLLETLQGIARSADYARIFYGDN
IAPIFEVILPMTTSVEEIERVYWLYKKAVVWISREKIYDITVREWIGDFFPEKINVIPLF
ETKSALIKAAKITEAYILNRKNDIEYQRVFFARSDPAMNYGLITAVTYVKRALYEVLKVE
EELSIPIYPIIGVGGPPLRGGMRPDNVDAVVKEYPSVQTFTIQSSFKYDYPTKDVVKAVE
KIKSTKRKLPIPVEIPPFLVNYEAEYQKQIRILAPYINSVAKRIPRRRKRKLHIGLFGYS
RNVNGITLPRAITFTAALYSIGIPPELLALNSLTDSQLETISEYYINVYEDLEFAMRFFS
PKVAEKVGLKELAERVKEFKPEQIPEYIEEAEIVFKGEGDVMKLAQLRGFLG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgataccaagaataatgagtactcaacatcctgacaactattcaataccatttttcgct
agctcccccatactagagggagaagatgagataacggaggcattctatgccttcagtgtc
cttggagcagatgaacaaatgtgggactttgaaggaaaagaagttgatgaattcgttgtt
aaaaaacttctcgagagatacccaacatttttcaagaacaatattcttggaaaggatatt
cgcctgaccccaagagttccaaacccaagtgtagaaaaagaagaagcaaagttacttctc
gaaacccttcaaggaatcgcaagaagtgcggattatgcaaggatattctatggagataac
atagctccaatattcgaagtaatacttcccatgacaactagtgtagaggaaattgagaga
gtatactggctctataagaaggcagtagtttggataagcagagagaaaatctatgatata
acagtaagggagtggatcggagatttcttcccagaaaaaattaatgtaatcccactgttt
gagacgaaatccgctctaatcaaagctgcaaaaataacagaagcttacatactaaatagg
aagaatgacattgagtatcagagggtcttttttgctagaagtgatcccgcaatgaactac
ggtctaattacagcagtcacttacgttaaaagggcactatatgaagttctaaaggtagaa
gaggagctcagcattccaatatacccaattatcggagttggtggtcctcccttgagagga
ggaatgagaccagataacgttgatgcagtagtaaaggaatatccaagtgtccaaaccttc
acaatccagagctccttcaagtatgactacccaaccaaagacgtcgttaaggcggtagag
aaaattaaatcgacaaaaagaaagttgccaattccagttgaaattcctccatttctggtt
aactatgaggcagaataccaaaagcagattagaattctagccccatacataaacagcgta
gcaaagagaatacccaggagaagaaagaggaagctccacataggattattcggatattca
agaaatgtgaacgggataactctgcccagagcaatcacattcactgctgccctttactcc
atcggaatccccccagaacttcttgcattaaactcactcacagactcccaactcgaaaca
atttcagaatactacatcaacgtatatgaagacttagaatttgccatgagatttttctct
ccaaaagttgctgaaaaggtaggattgaaagagctagcagaaagggtcaaggaattcaaa
ccagagcaaatccctgagtacattgaggaggcagaaatagtgtttaaaggggaaggagat
gtgatgaagctggcccagttaagagggtttcttggataa

DBGET integrated database retrieval system