KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_145816Help
Entry
MYCFIDRAFT_145816 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00250  Alanine, aspartate and glutamate metabolism
pfj00410  beta-Alanine metabolism
pfj00430  Taurine and hypotaurine metabolism
pfj00650  Butanoate metabolism
pfj01100  Metabolic pathways
pfj01110  Biosynthesis of secondary metabolites
Module
pfj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pfj00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MYCFIDRAFT_145816
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYCFIDRAFT_145816
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCFIDRAFT_145816
   00430 Taurine and hypotaurine metabolism
    MYCFIDRAFT_145816
Enzymes [BR:pfj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MYCFIDRAFT_145816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 19331321
NCBI-ProteinID: XP_007931573
JGI: 145816
UniProt: M3AK31
LinkDB All DBs
Position
Unknown
AA seq 501 aa AA seqDB search
LLSAVQSLVTSFIQAADDNTASNANGYSEHAKPVGDHRPTTLLDPNPPQQLQQLLACSLP
QQGLGRDGFIEMVQKLYRHSVNTWHQGFLDKLYASITPVGLAADLVLSSLNTNVHVYQVS
PALTIVEKQTGRALASMFGLNGVHAGGITQPGGSAANQSSMVIARNTLFPETKIEGNGNR
RFVLFTSVHGHYSVEKAAQMFGFGSNAVRAVEVDAQGRMKPDALSLAIQTSKTAGETPFY
VNATAGTTVLGSFDPIPPISKICQTHNLWLHIDGSWGGSIIFSDKQRHKLQGSHLADSIT
ICPHKMMNVPLTCSFLLGKDLRDFQRAMTLPAEYLFHGRNADGGERHCSDAHRNGGDTCA
EQEEFWDLADLTPQCGRRGDSLKLALSWIYSGTQGFRDYIDHAFDIAAQLTSILASNPNF
TLVSENPPPCLQVCFYFRKVADVEANSRMTERIAKGLVMRGFMVDYAMGREGSFLRVVVN
GQTRGETVVGLVRAVEEVGME
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
ctcctcagcgctgtgcagagtctagtcacgtccttcattcaagctgcagatgacaacaca
gcgtcaaacgcaaatgggtattccgagcacgcgaaacctgttggcgaccacagaccgacg
actctgctcgatccaaacccgccacaacaactccagcaactcttagcctgttcactgccc
cagcaaggcctcggacgagatggcttcatcgagatggtccaaaagctataccgccacagc
gtcaacacctggcaccaaggtttcctcgacaagctctacgccagcatcactccagtcgga
ctcgcagcagatttggttctcagctctctgaacacgaatgtccacgtctaccaagtctcg
cctgctctgacaattgtcgagaagcagaccggtcgtgctttggcttcgatgtttggtttg
aatggagtccatgctggtggcatcacgcagccgggtggaagtgctgcgaatcagagttct
atggtgattgcgcggaatactttgtttccggagacgaaaattgaagggaatggaaaccga
cgttttgttcttttcacgtcggtacatgggcattatagtgttgagaaggcggcgcagatg
tttgggtttggttcgaatgctgtacgtgcggttgaggttgatgcgcaaggacgaatgaag
ccagatgcattatcgctcgcaatccaaacctccaaaaccgccggcgaaacccccttctac
gtcaacgcaacagccggaacaaccgtcctcggctccttcgatcccatccccccaatctca
aaaatctgccaaacccacaatctctggctgcacatcgacggctcctggggcggctccata
attttcagcgacaagcaacgccacaaactccaaggctcccacctcgcagactccatcaca
atctgtccgcacaaaatgatgaatgtccctctcacgtgttctttccttttggggaaagat
ttgagggattttcagcgagcgatgacgcttcctgccgaatatctttttcatggtaggaat
gcggacggtggggaacgccactgctccgacgctcatcggaatggaggagatacatgtgcc
gagcaagaagaattctgggatctggcagatctcaccccccaatgcggtcggagaggggat
agtctcaaactcgccttgagctggatatattccggaacccaagggtttcgagattatatc
gaccatgctttcgacatcgcagcgcagttgacatctatcctcgcctcgaatccgaatttc
acgttggtttcggagaatccgccgccttgtttgcaggtttgcttttattttcggaaggtg
gctgatgttgaggcgaatagtaggatgacggagaggattgcgaaggggttggttatgagg
gggtttatggttgattatgcgatggggagggaggggagctttttgagggttgttgttaat
gggcagacgaggggggagacggtggtggggttggtgagggctgtggaggaggtggggatg
gagtag

DBGET integrated database retrieval system