KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_149067Help
Entry
MYCFIDRAFT_149067 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
Organism
pfj  Pseudocercospora fijiensis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 1018 aa AA seqDB search
MPGKLSRVIGTIKRKPTTAPDRKDDQEAALAPSQRKTSAIHDLIHLDMKDKKVIASGLTG
LASGEPMDDKELLLENGVSMLQGLPLNSGLSAATSDAFITMLYHDLPHPPTTMAGPTSRY
RRHDGGNNNPWNPEMGKAGTPYSRSVPPSKPKGPNLPDPELVFEQLMKREDGNFRKHPSG
LNRLFFSFATIVIHECFQTSREDPWINETSSYVDLSTLQDEDLFQLGRNINVGFFASVVL
KDYVAAILNTPRADSTWSLDLGKEIKKSGQRIERGTGNVVSTEFAVLYHWHAALSAADAQ
WMEGVLRANLPELKSVDDMTVEMFYKVMYQEGHKLRDTLPREWTFNGLKRAPDGRFNDHE
LAELIKDCIEEPAHAFGAHGTPASLKVVDIMGQLQARELFNVCTMNEFRSYLNLKAYESF
EEWNPDKKVARAAELLYGHIDNLELYPGLMAECTKPPMPGSGVCPGQTTGRGILDDAVAL
VRGDRFLSYDFNSNTLTNWGLSKVGTSVAGGAYGGVLPKLIMNGLPGAWTGTSLYALLQF
YTPEAAQGIVKQHKAIGQYDTTRPRSDLDIVSVQTSAGCKQVSEDLTSFRSIQPTATQTI
ANGNNFMLGSGDPKKAASLQRIFFEDGFVASVRKYFETEVSKLIKASSLRYSNGKRSFDV
VRDITNVTPITWLAERLAIPLKTVAQPRGLISQPQLFEAYMAIFLYQNFNIIPAHEWTLR
AGATQATALLTEVHSAHLSTQSGFKEHIVDWLAKGSAFEVKPEADRIYKALIATKEPNDK
LAGDCIGVAAPIAGILTHQASLLIDLYLRPGYEAYKARIIELSHKNDDASFKELQGFVFE
GMRHAGVVPGLPRQATRDITVQDGVRGPVNVKKGNIVLIATSKEALDPTSFAEPEKLNPH
RPLSEYTLLGSGLSFGASLIGPAIAATLKEVFKLPGIRRANGKPGHLATVEHFVGGIPVR
SYLDSNAKESPVPTTLVLEYDEAVAPLTNGVNGVNGGANGVHSLYTPSQTLAGPQNGS
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgcccgggaaactttcgagagtgatcggaacgatcaagcggaagcctacaacagctcca
gatcgcaaagatgaccaagaagcagctctggcacctagccagaggaagacttcggccatt
catgacctaattcacctggacatgaaagacaaaaaagtcattgcctcaggcctcactggt
ttggcatctggggagccgatggacgacaaggaactcctactagagaatggcgtgtccatg
ttacaaggtctgccgctcaatagtggcctctccgcagcaacttccgatgcattcatcacg
atgctctatcatgatttgccacaccctccgactaccatggctggcccaacttcgcggtat
cggagacatgatggaggcaacaacaatccatggaatccggagatgggcaaggctggcaca
ccatacagcagaagtgtcccacccagtaagccaaagggaccgaatctgccagaccctgag
ctcgtcttcgagcagctcatgaagcgagaggatggcaacttcagaaagcatccatctgga
ctgaaccggctgtttttctcctttgcaacgattgttattcacgagtgcttccagacatcg
cgcgaggatccttggattaacgagacatccagttatgtcgatctgagcactctgcaagat
gaagatttgttccagctcggcagaaacatcaatgttggattttttgccagcgtggttctg
aaggattatgtggctgccatcctgaacaccccgcgagctgattcgacttggtcactcgac
cttgggaaagagatcaagaagagtggacagcggatcgagcgaggtactggcaacgtcgtt
tcgaccgaattcgcagtcctctatcattggcacgctgcgctcagcgctgcagacgcgcaa
tggatggagggcgttctcagagcaaacctccccgaacttaagtccgtggacgacatgact
gtggagatgttctacaaagtcatgtatcaagaaggacacaagctcagagacacattacca
agagagtggacattcaatggcctgaagcgagctccagatggaaggttcaacgaccatgaa
ctcgcagagctgatcaaggactgcatcgaggagcccgcacacgcttttggtgctcatggc
actcctgcaagcttgaaggtggtcgatatcatgggacagctgcaggcgcgtgagctgttc
aatgtgtgcacgatgaacgaattccgaagctatctcaacctgaaggcgtacgagagtttc
gaggaatggaatccagacaagaaagtcgcgagggctgccgagctcctctacggacatatc
gataaccttgaattgtatcccggtctcatggcagaatgcacgaagccacctatgcctggc
agcggtgtgtgccctggccagaccaccggtcgaggtattttggacgatgctgtggcattg
gtgcgaggcgatcgcttcctcagctacgacttcaacagcaataccttgacgaactgggga
ttgagcaaggttggcacatctgtcgcaggaggagcttatggtggtgtgcttcctaagctg
atcatgaacggcctgccaggagcgtggacgggaacatcactttacgctttgttgcagttc
tacacgccggaggcagctcaaggtatcgtcaagcaacataaggccatcggtcagtacgat
accacgagacctcgcagtgaccttgacatcgtctcggtccagacgtcagcaggctgcaag
caagtgtccgaggatcttacttctttccgatctattcaaccaactgccacgcagactatc
gccaacggcaacaacttcatgcttggctctggtgacccgaagaaggcagcttctctccag
aggatcttctttgaggacggcttcgtcgccagcgtcagaaagtacttcgagactgaggtg
tccaagctcatcaaggctagctcgcttcgctattccaacggcaagcgctcattcgatgtc
gtacgggatatcactaacgtcacacctatcacatggcttgccgagcgactcgctatcccg
ctcaagacagttgctcaacctcgcggcctgatctcccaaccccagcttttcgaagcatac
atggccatattcctctaccagaacttcaacatcatccccgctcacgaatggactttgcgt
gctggtgccacccaggccacggcgctgttgactgaagtccacagcgcccacctctcgacc
cagtccggcttcaaggaacatatcgtggactggctggccaagggctctgcgtttgaggtg
aagcctgaggcagaccgcatctacaaagctctcattgccaccaaggagcccaacgacaag
cttgctggcgattgtatcggtgtcgcggcaccgatcgccggcatcctcacccaccaagcg
tcgctccttatcgatctctacctccgcccaggctatgaagcatacaaggctcgcattatt
gagctctctcacaaaaacgacgatgcttcattcaaagagctccagggctttgtgttcgag
ggcatgcgacatgctggcgttgtgcctgggctgcctcgtcaagccactagagacatcaca
gtccaggacggcgttcgcggcccagtaaatgtcaagaagggcaacattgtcctaatcgcc
acgagcaaggaggctttagacccgacatctttcgccgagccggagaagctcaacccccac
cgccctttgagcgagtacactcttctcggcagcggtctcagctttggagccagcttgatc
ggacctgcgattgctgcgactttgaaggaagtgttcaagttgcctgggatccgccgtgcg
aatggcaagccgggtcacttggcgactgtggagcacttcgtcggaggcatcccagtgagg
tcgtacctggattcaaatgcgaaggaatcgcccgttcctactacgcttgtgcttgagtac
gacgaggctgtcgctccacttacaaacggagtcaatggggtcaacggtggcgccaacggg
gttcactccctctacactccttcccagactctagccggaccacagaacggctcgtga

DBGET integrated database retrieval system