KEGG   Pseudomonas protegens Pf-5: PFL_0261Help
Entry
PFL_0261          CDS       T00249                                 

Definition
(GenBank) AMP-binding protein
Organism
pfl  Pseudomonas protegens Pf-5
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
305433..307295
Genome map
AA seq 620 aa AA seqDB search
MNYAVPRDYLNDVNPAISAHVAVDDLPLAEVPGIECLSSVTEVLAYRAWRQPDAIAFIHL
LDGEREEASISYAELWKRSQRLAAALQIFEPREKRVLMLFETGIDYIVSLFGLLLAGAVA
IPAFPPVGTRGLERLALICADAHPQLVLTSSRFMRSQERVNALLQGDLPVPQWVDPEQLA
EADSSWRGQALAHGQLALLQYTSGSTSAPKGVMLTHDNLYSNCRSASQWMGPARNRVGCS
WLPPYHDMGLMGGILQPIFDAFPTVLISPGHFVQRPLRWLDAVSRYGADVTIAPNFAFDL
CVENITDEELAELDLSKLKAIYCGAEPVRQSTLARFSERFAAAGFNPAALGPCYGLAEAT
VLVSGKRHDEPAFNTQVDRDQLASGTLAIVDAEDARALPLVSSGRVAPGLRVAIVDPVSL
QPVADGQIGEIWVQGDNVGAGYWGKEALSQQVFRASLPGIHGRFMRTGDLGALHRDELFV
TGRLKDLIIIAGRNLYPQDLELAVESADPRIRSNGCVAVGIDNGQQEQLAIVAEVKRSEK
LDEAQQEQLRQVITSALVSQFGVAPARIHLAPMGGIPLTTSGKVQRQATRKALLNDTLAR
YGASRAAAAPTLKTATDALS
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgccgtgcctcgtgattatcttaatgatgtcaatccagccatctcagcgcat
gtagcagttgatgatctgccgttggccgaagtcccgggcatcgaatgtttaagttcggtt
accgaagtactggcctatcgcgcatggcggcaacccgatgccattgccttcatccatctg
ctcgatggcgagcgggaggaggcgtcgatcagctacgccgaactgtggaagcgtagtcaa
cgattggccgccgcgctgcagatcttcgagccccgtgaaaaacgggtgctgatgctgttc
gagaccggtatcgactacatcgtttcactgttcggcctgctgctggccggtgccgtggcg
atcccggcctttcccccagtggggacccgggggctggagcggctggcactgatctgcgct
gatgcccatccgcaactggtgctcaccagctcgcgcttcatgcggtcccaggagcgggtc
aacgctctgctccagggtgatttgcccgtgccccagtgggttgacccggagcagttggcc
gaggcggattcatcctggcgcgggcaggcgctcgcccacggccaactggccctgctgcaa
tacacctcgggctccacctcggcgcccaagggcgtgatgctgacccacgacaacctctac
agtaattgccgcagtgccagccagtggatgggcccggccaggaatcgcgtgggttgcagc
tggctgccgccctatcacgacatgggcctgatgggcggaatcctgcagccgatcttcgat
gccttccctaccgtgctcatcagccccgggcactttgtccagcgaccgctgcgctggctg
gatgcggtgtccaggtacggcgccgacgtcaccatcgcgcccaacttcgccttcgacctg
tgtgtcgaaaacatcaccgacgaggaactggcagagctcgacctgagcaagctcaaggct
atctattgcggggccgagccggtgcgccagagcaccctggcgcgcttctccgaacgtttt
gccgccgccggcttcaacccggcggccctgggcccctgctacgggttggccgaggccacc
gtactggtctcgggcaagcgccacgatgagccggcgttcaatacccaggtggatcgggac
caactcgccagtggcaccctggccatcgtcgatgccgaggatgcccgggccctgccgctg
gtcagtagcggcagagtcgccccgggcctgcgcgtggcgattgtcgaccctgtcagcctg
caaccggtggcggacggccagatcggcgagatctgggtccagggcgacaacgtgggcgcc
ggctactggggcaaggaagcgctgagccagcaggtgtttcgcgccagcctgccgggcatc
catgggcgtttcatgcgcaccggcgatcttggcgcgctgcaccgcgatgagctgttcgtc
accgggcgcctcaaggacctgatcatcattgccgggcgcaacctgtatccccaggacctg
gagctggcggtggaaagcgccgacccgcgcatccgcagcaacggctgcgtggcggtgggc
atcgataacggccagcaggaacaactggcgatcgtggccgaggtcaagcgcagcgagaaa
ctcgatgaagcccagcaggaacagctgcgccaggtgatcaccagtgcgctggtcagccag
ttcggcgtggccccggcgcgcatccacctggcgcccatgggcggcattccactgaccacc
agtggcaaggtccagcgccaggccacccgcaaggccctgctcaacgacacgctggcgcgc
tatggcgccagtcgcgcggctgcggcacctacccttaaaactgctacggatgccctgtca
tga

DBGET integrated database retrieval system