KEGG   Anthracocystis flocculosa: PFL1_01019Help
Entry
PFL1_01019        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
pfp  Anthracocystis flocculosa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PFL1_01019
Enzymes [BR:pfp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PFL1_01019
Glycosyltransferases [BR:pfp01003]
 Polysaccharide
  Storage polysaccharide
   PFL1_01019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 750 aa AA seqDB search
MSVEKRDVHNPLLFEAAWEVANKVGGIYTVIKTKAPVTQQEYGDRYCLIGPLSYKTAPME
VEALEPEEPALKATLESMKAAGVKYLYGRWLIERAPKVLLFDTGSMYHRMDEWKGDLWNL
AGIPTPPNDHETNETLIFGYMVAWFLGEFVTRERKKAVIAHFHEWQAGLAIPLCRKRHID
VTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSAAHCADVFTT
VSHITAYESEHLLKRKPDGVLPNGLNVVKFSAMHEFQNLHAVSKHKINEFIKGHFYGHYD
FDLDNTLYFFTAGRYEYRNKGVDMFIEALARLNYRLQKAGSKVTVVAFIIMPAETKSYTI
EALKGQAVTKQLRDTVEQIQARIGERLFERTARYQGDSGTDIIDPSQLLSDADKIALKKR
VFALKRNSLPPVVTHNMADDSNDPILNQIRRVQLFNRSSDRVKMIFHPEFLNANNPILGL
DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCFMEDTIERGEDYGIY
IVDRRMKSVEDSVNQLADQMFTYAQKTRRQRINQRNRTERLSELLDWKRLGLEYAKARQL
ALRRAYPDSFEDDEDIDSYFDDIAAGGKMQPPMSVPGSPRLPPSGMRTPGEFGTLTEELQ
SLSTSDYRGSQQFWRAMSQHGSDDEEEAAYKFPLVMKARNRGTSVGSMSGASTPGLGGGK
VLSSADLDRADQALSSHNHPNGANGNGNGN
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcgagaagcgcgacgtccacaacccgctcctctttgaggcggcgtgggaggtc
gccaacaaggtcggaggcatctacaccgtcatcaagacaaaagcccccgtcacgcagcaa
gagtacggggaccgctactgcctgattggcccgctctcgtacaagacggcgcccatggag
gtcgaggcgctcgagccagaggagcccgcgctcaaggccaccctcgagagcatgaaggcg
gcaggcgtaaagtacctctacggcaggtggctcatcgaacgcgcgccaaaggtgctcctc
tttgacaccggcagcatgtaccaccgcatggacgagtggaagggcgacctctggaacctc
gccggcatccctacgccgccaaacgaccacgagacaaacgagacgctcatcttcggctac
atggtcgcctggttcctcggagagtttgtcacgcgagagcgcaagaaggccgtcatcgcc
cacttccacgagtggcaggccggactcgccatcccgctctgccgaaagaggcacattgac
gtgaccaccatcttcaccacccacgccacgctgctgggccgatacctgtgcgccggcagc
gtcgacttctacaacaacctgcagtactttgacgtcgaccacgaggcgggcaagcgcggc
atctaccaccgctactgcatcgagaggtcggcagcccactgcgccgacgtcttcaccacc
gtcagccacatcacggcctacgagagcgagcacctgctcaagcgcaagcccgacggcgtg
ctgcccaacggcctcaacgtggtcaagttctccgccatgcacgagttccaaaacctccat
gccgtctccaagcacaagatcaacgagttcatcaagggccacttctacggccactacgac
tttgacctcgacaacacgctctacttcttcaccgcgggcaggtacgagtaccgcaacaag
ggcgtcgacatgttcatcgaggcgctcgcccggctcaactaccgcctgcaaaaggccgga
tccaaggtcaccgtcgtcgccttcatcattatgcccgccgagaccaagtcgtacacgatc
gaggcgctcaaggggcaggccgtgaccaagcagctgcgcgacacggtcgagcagatccag
gcgaggatcggcgagcgtctgtttgagcgcacggcgaggtaccagggcgacagcggcacc
gacatcatcgacccatcgcagctgctctcggacgccgacaagatcgcgctcaagaagcgc
gtctttgcgctcaagcgcaactcgctgccgcctgttgtcacgcacaacatggccgacgac
agcaacgatcccatcctcaaccagatccgccgcgtccagctcttcaaccgctcgtcggac
cgcgtcaagatgattttccaccccgagttcctcaacgccaacaacccgatcctcggtctc
gactacgaggagtttgtgcgcggctgccacctcggcgtcttcccgtcgtactacgagcct
tggggctacacgccggccgagtgcaccgtgatgggcatcccctcgatcaccaccaacctc
tccggcttcggctgcttcatggaggacactatcgagcgcggcgaggactacggcatctac
atcgtcgaccgccgcatgaagagcgtcgaggacagcgtcaaccagcttgccgaccagatg
ttcacatacgcgcaaaagacgaggaggcagcgcatcaaccagcgcaaccgcaccgagagg
ctgtcggagctgctcgactggaagcgcctcggcctcgagtacgccaaggcgaggcagctg
gcgctgcgccgcgcctaccctgactcgttcgaggacgacgaggacatcgacagctacttc
gacgacatcgccgcaggtggcaagatgcagccgcccatgtcggtgcccggatcgccgagg
ctgccgccgtcgggcatgcgcacgcccggcgaattcggcacgctcaccgaggagctgcag
agcctgagcacgtccgactaccgcggctcgcagcagttctggagggccatgagccagcac
ggatccgacgacgaggaagaggccgcctacaagttcccgctggtcatgaaggccaggaac
cgaggcacctcggtgggcagcatgagcggcgcatcgacgcccgggctgggcggaggcaag
gtcctgtccagcgccgacctcgaccgcgccgaccaggcgctcagctcccacaaccacccc
aacggcgccaacggcaacggcaacggcaactag

DBGET integrated database retrieval system