KEGG   Anthracocystis flocculosa: PFL1_03946Help
Entry
PFL1_03946        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
Organism
pfp  Anthracocystis flocculosa
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 601 aa AA seqDB search
MRTSASLPPSAPPEGLRVGYLLSSSLLESSDLLPSNQGRSTLVHSLIYHLDLLDLRHLAA
ADDDDQRGSASPEPNDASPPTKRRKTSARKSEYRRLLRHLGADVGGEREMDEAGRLENRA
VVYEPRRATRQELEVYHDKAFVRRLLDGEQEQAEEVAPKDGTDSDSNDEERPRPLRPPSP
SNRDATEQRAQPRTKNQFGLVDDCPPFEGLKDHVELVAGASIRAAELLATGEVDVAIAWD
GGRHHAKKDAASGFCYVNDAVLAILALRKLRKRRVPVVEQCLAPNGGADGTETATTAPKT
PPGPKRYKTVSTRMDRILYLDLDLHWGDGVEEAFYTSSSVLTLSIHHYAPGFFPCYHAAP
SAASSAANGDAQVAAASTKHGAPGSLECTGGPSGSAAASKALCLPLLPGANGDSLRRVLK
ANVESIVETFDPECIVVQFGLDGLAGDPMATWNLDALSILHALSLILSWTRPRAGSDTAT
SPERKLLLLGGGGYDNANTAKVWSLITAFVLGRFHQDSDRDRRDGEVGEGRETARGNTVD
LNTAIPESCPSWPRFDGGSLDVKAGEMVDTNDEAHFDKVDVVFQRHAATLAAQRSSTNKT
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaggacctcggcatccctgccgccatcggcgccgcccgagggtttgcgggtaggctac
ctgctctcgtcctcgctgctcgagagcagcgacctcctcccttccaaccagggtcgatcc
acgctggtccacagcctcatctaccacctcgacctcctcgacctgcgccacctcgccgcc
gccgacgacgacgatcagcgtggatcagcatcgcccgagcccaacgacgcttcgccgccc
acaaagaggaggaagacgtcggcgcggaaatccgagtacaggcggctcctgcgtcacctc
ggcgcagatgttggaggcgagagggagatggacgaggcgggcaggctcgagaacagagct
gtggtctacgaacctcgtagagcgacgaggcaggagctcgaagtgtaccacgacaaggcg
tttgtcaggcggctactggatggggagcaggaacaggcagaggaggtcgctcccaaagat
ggcaccgacagcgacagcaatgacgaggagcgaccacggccgctccgacccccttcgccc
tcgaatcgagatgccacagaacaacgagcgcagcctcgaaccaagaaccagtttggactt
gtcgatgactgcccaccgttcgagggactcaaagatcacgtggagctggtggcgggagcg
tcgatccgtgccgccgagctattggcgacgggcgaggtcgatgtagccatcgcctgggac
ggcggcagacaccatgccaagaaggacgccgcgtccgggttctgctacgtcaacgacgcc
gtgctcgccatcctggcgctgcgcaagctgcggaagcggagggttcccgtcgtcgaacag
tgtctcgctccgaacggcggagcagatgggaccgagacggcgacaacggcgccgaagacg
ccaccgggcccgaagcgctacaagaccgtctcgacgcgcatggaccgcatcctctacctc
gacctcgacctgcattggggcgacggcgtggaagaggccttctacacgtcctcctcggtc
ctcacgctgtccatccaccactatgcgccgggcttctttccgtgctaccacgccgcgccc
tctgctgcgtcgagcgccgcgaacggagatgcacaggttgcggcggcgagtacgaagcac
ggcgcgccgggatcgttggaatgcacgggtggaccatcgggctcggcagcggccagcaag
gccctgtgcctcccgctgctcccgggcgccaacggcgacagcctgcgtcgcgtgttgaag
gccaacgtcgagagcatcgtcgagacgtttgatccagagtgcatcgtggtccaattcggc
ctggacggtctagccggcgatccgatggcgacgtggaacctggacgccttgagcatccta
catgctctgtccctcatcctctcctggacccgtcctcgagccgggagcgatacggccaca
tcgcccgagcgcaaactgctcctcctcggcggaggcgggtacgacaatgccaataccgcc
aaggtctggtcgctcatcactgcctttgtcctcggtcgttttcatcaagacagcgatcgg
gatcgtcgggacggggaagtgggagagggacgagaaacggcaagaggaaataccgtggac
ctcaacacggccataccggaatcctgcccctcctggccccgctttgacggtggatccctc
gacgtcaaggccggcgaaatggtggataccaacgacgaggcccactttgacaaggtcgac
gtcgtctttcagcgccatgccgccacgttggctgctcaacggtcgtcgacgaacaagacg
gcatga

DBGET integrated database retrieval system