KEGG   Propionibacterium freudenreichii subsp. freudenreichii DSM 20271: RM25_1150Help
Entry
RM25_1150         CDS       T03860                                 

Definition
(GenBank) 2-oxoglutarate decarboxylase
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pfre  Propionibacterium freudenreichii subsp. freudenreichii DSM 20271
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfre00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RM25_1150
  Amino acid metabolism
   00310 Lysine degradation
    RM25_1150
   00380 Tryptophan metabolism
    RM25_1150
Enzymes [BR:pfre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     RM25_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1324057..1327842
Genome map
AA seq 1261 aa AA seqDB search
MGTDKFGANDWLIADMRQRYLADPTSVDERWRAYFQALGVTPDPSTPVASPAPVTPAPTQ
APTPQAPTPQAPTSSAPGPNEPAQPPSSRVQAPVPTLEPREIRRNAPEQPGMGGGLSADV
PNPAVRPAKKAEGQATRTVLRGIPKTTAVNMNESLSVPTATSVRQVPMKLVIDNRALVNS
FMARTRGGKVSFTHIIAFAMVQAIRDVPEMNHSFDMTDGKPTLVENPAINLGIAIDTTAK
NGTRELLVPNIKDAGNLDFAQFWSAYEDLVDRTRSGKLTLEDYAGTTVSITNPGGIGTNM
SVPRLMSGQAMIMGVGSIDYPAAFQGTSTQRTNDAAISKVCTLTSTYDHRIIQGAVSGEF
LRRIHQLLLGADGFYEHIYEALRIPYPPLHWDRDFTANSQSEISKGARVTELIQAYRAEG
HLLADLDPVEYRMRTHPDLDLATHGLSIWDLDREFPVGRFGGEEGRHIVLRQMLDILRES
YCYTLAIEYMHIDDPEERAWVQERFERPRKPRPREEHLLILDRLSEAEVFETFLQTKYVG
QTRFSMEGAESSIVILSELCAAAADGGMAEVSIGMPHRGRLNVLTNVVGKLYSQVFREFD
NKVPTEEDITGDVKYHLGATGQFTAMSGEKIKVSLAANPSHLEAVDPVLEGIARAKRDRQ
PVPADYPVLPILMHGDASFSAQGIVYEVLQMSQLRPYRVGGTVHLVVNNQLGFTTSPSDG
RSSKYCTDVAKALGAPVIHVNGDDPDACARAAELAFDFRARFHKDVVIDMVCYRLRGHNE
GDDPSFTQPQMYDLVARKGSVRKIYTDALIGRGDISVEDAEQAVNRFRARLEEVFSMVRN
PEIPRDEVDHQVAYRLAPQYPAKERAASAPPTPTREQFERVADVYENLPEGFTPHPKVGP
QLKRRADSIHNGPVDWATAELLAFGTLLQDRRHVRLVGQDTRRGTFSQRFGAVVDRVTNE
AWVPLKHLSDDQAPFDIYDSNLTEYAGMGFEYGYSTAAPDALVLWEAQYGDFANGAQTIA
DEFISSGFAKWQQRSGVVLLLPHGYEGAGPDHSSCRIERWLQTADEGNIAVTMPSTAASY
FHLLRQHAYVNWHRPLVVATPKSMLRNKAAASPLSDLLDEPWRPALADPTITDPGAVRRV
LLCAGKIRWDLVAERRKLGLDGQIAIVSLERLFPLPTAELAEILRAFPQVNDFRYVQEEP
ENQGAWEFMDRFLTPALSEALNRPFRMRPVTRPRSSAPSVGSHTVHLAQQRSLLAESLGQ
D
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
atgggtactgacaaatttggggccaatgactggctcattgccgatatgcgccagcgctat
ctggcagatcccacttctgttgatgagaggtggcgcgcatacttccaggcactgggagtc
acgcccgatccgtcaacgccggtggcaagcccggccccggtgaccccggcgccaacgcag
gcccccaccccgcaggcccccaccccgcaagcaccgacctcgagcgcaccggggcccaat
gaacctgcccaaccaccgtccagccgcgttcaggcccccgtccccaccctcgagccccgc
gagatccggcggaacgcccccgagcagcccggcatgggtggcggcctgtccgccgacgtg
cccaacccggcagtccgtcccgccaagaaggcggagggccaggccacccgcaccgtgctg
cgcggcattccgaagaccaccgccgtcaacatgaacgaatcgctgtcggtgcccacggcc
acgtccgttcgccaggtgccgatgaagctcgtcatcgacaaccgggcgctggtcaacagc
ttcatggcccgcacccgcggcgggaaggtgagcttcacccacatcatcgccttcgccatg
gtgcaggccatccgtgacgtcccggagatgaaccactcgttcgacatgaccgacggcaag
ccgacgctcgtggagaacccggcgatcaacctggggatcgcgatcgacacgacggcgaag
aacggcacccgggagctgttggtgcccaacatcaaggacgccggcaacttggactttgcg
cagttctggtcggcctacgaggatctcgtggaccgcacccggtcgggcaagctgacgttg
gaggactacgccggcaccacggtgtcgatcaccaacccgggcggcatcggcaccaacatg
tcggtgccgcgcctgatgagcggccaggccatgatcatgggcgtcggaagcatcgactat
ccggccgccttccagggaaccagcacgcagcgcaccaacgacgccgcgatctccaaggtc
tgcaccctgacgtccacctatgaccaccgcatcatccagggggccgtctccggggaattc
ctgcgtcgcatccaccaattgctcctgggcgccgacggcttctacgagcacatctatgag
gcacttcggatcccctatcccccgctgcactgggaccgcgatttcaccgcgaactcgcag
tcggagatctccaagggcgcccgcgtcaccgaactgatccaggcctaccgggccgagggc
cacctgctggccgacctcgatccggtggagtaccggatgcgcacccaccccgacctcgac
ctggccacacatggcctgtccatctgggaccttgaccgtgagttccctgtgggccgcttc
ggtggcgaggaggggcgccacatcgtgctgcgccagatgctcgacatcctgcgcgagtcg
tactgctacacgctggccatcgagtacatgcacatcgacgatcccgaggaacgggcatgg
gtgcaggaacgcttcgagcgtccgcgtaagccccgcccccgggaggaacacctgctgatc
cttgaccggctcagtgaggcggaggtcttcgagaccttcctgcagacgaagtacgtcggg
cagacgcggttcagcatggagggcgcggagtcgtccatcgtcatcctgtcggaactgtgt
gcggccgccgccgatggtggaatggccgaggtgagcatcgggatgccccaccgtgggcgg
ctcaatgtgctgaccaatgtggtgggcaagctctacagccaggtgttccgcgagttcgac
aacaaggtgcccaccgaggaggacatcaccggcgatgtgaaataccacctcggcgcgacc
ggccagttcacggccatgtcgggggagaagatcaaggtctcgttggccgcgaatcccagc
cacctggaggccgtcgatccggtgctggagggcattgcgcgggccaagcgtgatcgtcag
ccggttcccgccgactaccccgtgttgccgatcctcatgcacggcgacgcgtcgttctcg
gcgcagggcatcgtctacgaggtgctgcagatgagccagctgcgcccctaccgggtgggc
ggcaccgtgcacctggtggtcaacaaccagctgggcttcaccacctcacccagcgacggg
cgttcctcgaagtactgcaccgatgtggccaaggccctcggggcaccggtgatccacgtg
aacggcgacgatcccgatgcctgtgcccgggccgccgaactcgccttcgacttccgggcc
cgcttccacaaggacgtcgtcatcgacatggtctgctaccgcctgcgcggtcacaatgag
ggtgacgatcccagcttcacccaaccgcagatgtatgacctggtggcccgcaagggttcg
gtgcgcaaaatctacaccgacgccctgatcgggcgcggcgacatctcggtggaggatgcc
gagcaggcggtcaaccgcttccgggcccgtctcgaggaagtgttctcgatggtccgcaat
cccgagatcccccgcgacgaggtggaccatcaggttgcgtaccgcctggcgccccagtac
ccggccaaggaacgggccgccagcgccccgcccactcccacccgggagcagttcgagcgg
gtggccgacgtctatgagaacctgcccgaggggttcaccccgcatccgaaggtgggtccc
cagctcaagcggcgcgctgattccatccacaatggtccggtcgattgggcgaccgcggag
ctgttggccttcggcacgctgctgcaggatcgtcgccacgtgcgcctcgtcggacaggac
acccgtcggggaaccttcagccagcgcttcggtgccgtggtcgatcgggtgaccaacgag
gcctgggtgccgttgaagcacctgtcggacgatcaggcccccttcgacatctatgactcg
aacctcaccgaatatgccgggatgggctttgagtacgggtactcgacggccgctccggac
gccctggtgctgtgggaggcccagtacggcgacttcgccaatggcgcccagaccattgcc
gacgagttcatctcctcgggcttcgccaagtggcagcaacgctccggcgtcgtcctgctg
cttccgcacggctatgagggtgcgggacccgatcattcgtcgtgccgcatcgaacgctgg
ttgcagaccgccgacgaggggaacatcgccgtgacgatgcccagcacggcggcaagctac
ttccacctgctgcgccagcacgcctatgtgaactggcaccgtccgctggtggtggccaca
ccgaagtcgatgttgcgcaacaaggcggcggccagcccactgagtgacctgctggacgag
ccctggcggcccgcgctggccgatcccaccatcaccgatcccggagccgtgcggcgcgtc
ctgctgtgcgccggcaagatccgctgggacctggtggccgagcgccgcaagctcggtctg
gacgggcagatcgccatcgtctccctggagcggttgttcccgctgccgaccgccgagctc
gccgagatcctccgggcgttcccgcaggtcaacgacttccgctacgtgcaggaggagccc
gagaaccagggggcctgggaattcatggaccgcttcctgacccccgcgctctcggaggcg
ctgaataggcccttccggatgcgtccggtcacccggccccgttcgtcggcgccctcggtc
ggctcccacaccgtgcacctggcgcagcagcgctcgttgctggcggaatcgctcggccag
gactga

DBGET integrated database retrieval system