KEGG   Pseudomonas fluorescens SBW25: PFLU_2762Help
Entry
PFLU_2762         CDS       T00899                                 

Definition
(GenBank) putative trehalose synthase protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
pfs00500  Starch and sucrose metabolism
pfs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PFLU_2762
Enzymes [BR:pfs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PFLU_2762
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PFLU_2762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C MMPL
Motif
Other DBs
NCBI-ProteinID: CAY48992
UniProt: C3KAW9
LinkDB All DBs
Position
3050938..3054285
Genome map
AA seq 1115 aa AA seqDB search
MAKKPNAATFIKDPLWYKDAVIYQVHVKSYFDSNNDGIGDFPGLIAKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVHSDYGTMADAKRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARKAKPGSAARDFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHDVLKQIRA
EIDAHYPDRMLLAEANQWPEDTQLYFGDKKGDDGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDKERDYLWNYYAADRRARINLGIRRRL
APLMERDRRRVELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRADPASLVLPPIMDPQYGYQSVNVETQAQDPHSLLNWTRRMLAVRKQSKAFGRGSLKM
LSPSNRRILAYTREFTGEDGRNEIILCVANVSRSAQAAELDLSAFAGMVPVEMLGGNAFP
PIGQLNFLLTLAPYGFYWFVLAPENQMPSWHVEPAQSMPDFTTLVLKKRMEELLEEPCRA
SLEQTALPAWLPKRRWFAGKDTAIDSVRIAYGVRFGDPQHPVLLSELEVSAGGQFSRYQL
PFGFLGEDQFTSALPQQLALARVRRVRQVGLVTDAFSLEHFIRAVIQGLQAGTVLDSSEG
ELRFTATPHLAKLQLTDESEVRYLSAEQSNSSVVVGESLVLKLIRKVASGVHPELEMSAY
LTEAGYPNISPLLGSMIRHDAEGQDNLLMIAQGYLSNQGDAWGWTQNNLERAIRDELAEA
ISEQEQHYNALGELADFAGLLGQRLGEMHGVLGAKTTHKDFKPEVTTAKDTQAWAKDVGA
QLDRALHLLNLHQNQLNPADQALVTELLAQKKAITRHVQALAKATLGGLRIRVHGDLHLG
QVLVVKGDAYLIDFEGEPARPLHERRGKHSPYKDVSGVLRSFDYAAAMALNVQGVDHSPE
ADQARKRVTDRYLKEARQAFIQAYQSAASTLAHDWQDAKGQDAALTLFSLEKAAYEVAYE
AENRPTWLPVPLQGLHGLLSGLAPISNTARGGETS
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaacccaacgctgccacttttatcaaagacccgctctggtacaaagatgcg
gtgatctaccaagtccacgtcaaatcgtatttcgattccaataacgacggtatcggtgat
tttccaggcctgatcgccaagctcgactacatcgccgacctgggtgtgaacaccatctgg
ttgctgccgttctacccctcgccacgccgtgacgatggctacgacatcgccgagtaccgt
ggcgtgcacagcgactacggcaccatggccgatgccaagcggtttattgccgaggcgcac
aagcgcgggctgcgggtcattaccgagctggtgatcaaccacacctccgaccagcatccc
tggttccagcgtgcgcgcaaggccaagcccggctcggcggcgcgggacttctacgtgtgg
tcggatgacgaccagaaatacgacggcacccgcatcatcttcctcgacaccgagaagtcc
aactggacctgggatccggttgcgggccagtatttctggcaccgcttttattcccaccag
cccgatctcaacttcgataacccgcaggtcatgaaagcggtgttgtcggtgatgcgctac
tggctggacatgggcatcgacggcctgcgcctggacgccatcccgtacctgatcgaacgc
gatggcaccaataacgaaaacctgcccgaaacccacgatgtgctcaagcagatccgtgcc
gagatcgacgcgcattacccggaccgcatgctgctggccgaggccaatcaatggccggaa
gacacccagctgtatttcggtgacaaaaagggcgacgacggcgacgaatgccacatggcc
ttccactttccgctgatgccgcgcatgtacatggcgctggcgcaggaagaccgcttcccg
atcaccgacattctgcgccagaccccggagattcccgccaattgccagtgggcgatcttc
ctgcgcaaccacgatgaactgaccctggaaatggtcaccgacaaagaacgcgactacttg
tggaactactacgccgccgaccgccgcgcgcgcatcaacctcggcatccgccggcgcttg
gcgccgttgatggaacgtgaccgccgtcgtgtcgaactgctcaacagcctgctgctgtcg
atgcccggtacaccgaccctgtattacggcgatgaaatcggcatgggcgataacatctac
ctgggtgaccgcgatggcgtacgtacgccgatgcagtggtccatcgaccgcaacggcggt
ttctcccgcgccgacccggccagcctggtgctgccgccgattatggacccgcaatacggc
taccagtcggtgaacgtcgagacccaggcccaggacccgcattcgttgctgaactggacc
cggcgcatgctggcggtgcgtaagcagtccaaggcgtttggccgtggcagcctgaaaatg
ctctcgccgagtaaccggcgcatcctcgcctatacccgcgagttcaccggtgaagacggg
cgcaacgagatcatcctctgcgtggccaacgtgtcgcgcagcgcccaggcggccgaactg
gacctgtcggcgtttgctggcatggtgccggtggagatgctcggcgggaatgccttccca
cccatcggccaactcaatttcctgctgaccctggcgccttacggcttctattggtttgtg
ctggcgccggaaaaccagatgcccagctggcatgtggaaccggcccagagcatgccggac
ttcaccacgctggtattgaaaaaacgcatggaagaactgctggaagaaccctgccgcgcc
tcgctggaacaaacggcactgccggcctggctgcccaaacgccgctggttcgcgggcaag
gacacggcgatcgacagcgtgcgcatcgcctatggcgtgcgctttggcgacccgcagcac
ccggtattgctcagcgagcttgaggtcagtgcgggtggccaattcagccgctatcagctg
ccgttcggtttcctcggtgaagaccagttcaccagcgccttgcctcagcaattagccttg
gcccgtgtacgccgggtgcgccaggtaggcttggtgaccgatgccttcagcctcgagcac
tttatccgcgccgtgatccagggtttgcaagcgggcaccgtgctcgactcaagcgaaggc
gagctgcgcttcaccgctacgcctcatctggccaagctgcaactgacggatgagtccgag
gtgcgctatttgtcggccgagcagtccaacagttcggtagtagtgggcgagagcctggtg
ctcaagctgatccgcaaagtcgcctccggcgtgcaccctgagttggagatgagtgcttac
ctgaccgaagccggctacccgaacatctcgccgttgttgggctcgatgattcgccacgac
gccgagggccaggacaacctgctgatgattgcccaaggctacctgagtaaccagggcgac
gcctggggctggactcagaacaacttggaacgggcgattcgcgacgagctggccgaagcc
atctccgagcaggaacagcactacaacgccctgggcgagctggcggattttgccgggttg
ctcggccagcgcctgggcgaaatgcacggggtgctcggtgcgaaaaccactcacaaggac
ttcaagcctgaagtcaccaccgccaaggacacccaggcctgggccaaggatgtcggcgcg
cagctggaccgtgcgttgcacttgctcaaccttcatcaaaaccagttgaacccggcggat
caagcgctggtcactgagttgctggcgcagaaaaaagccatcacccgccatgtgcaggcg
ctggcgaaagccaccctgggtgggttgcgtattcgggtgcatggtgacttgcacctgggc
caggtgctggtggtgaagggcgatgcctacctgatcgactttgaaggtgagccggcgcga
ccgctgcacgaacgacgcggtaagcacagcccgtataaagatgtgagcggcgtgttgcgc
tccttcgattacgcggcggccatggctctgaatgtacaaggggtggatcactcgcccgaa
gcggaccaggcgcgcaaacgcgtgacggaccgttacctgaaagaagcacgccaggccttt
atccaggcgtatcagtctgctgcgtctacactggcgcatgactggcaggatgccaaaggc
caggacgcagcgctgacgttgttcagcctggagaaggccgcgtatgaagtggcttacgaa
gcggaaaaccgcccgacttggttgccggtgcccctgcaagggttgcacggactgttgagc
gggcttgcacctatatcgaacactgcacgcggtggggagacgtcatga

DBGET integrated database retrieval system