KEGG   Pseudomonas fluorescens SBW25: PFLU_4387Help
Entry
PFLU_4387         CDS       T00899                                 

Gene name
pvsA
Definition
(GenBank) pyoverdine synthetase A
Organism
pfs  Pseudomonas fluorescens SBW25
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4840928..4853818)
Genome map
AA seq 4296 aa AA seqDB search
MMDAFELPQTLVHSLQRRAAQTPDQVALRFLAESAEHSVVLSYRDLDLRARTIAAALQSN
VDLGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESTRRHHQERLLSIISDAEPRLL
LTIASLADGLAQIENAPPVLSVDSLESADNWIAPDLQPDDIAFLQYTSGSTALPKGVQVS
HGNLVANEVLIRRGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLMSPAYFL
GRPLRWLEAISEYGGTISGGPDFAYRLCSERVSDSALERLDLSQWRVAYSGSEPIRLDTL
ERFAEKFATCGFTPNNFFASYGLAEATLFVAGGTRGHGIPALRVDEQALAANRAEPGQGS
AIMSCGTHQPEHAVLIADPQTLTELPDNRVGELWASGPSIAHGYWRNPEATAKTFVQHAG
RTWLRTGDLGFIRDGEVYITGRLKDLLIVRGHNLYPQDIEQTIEREVEVVRKGRVAAFAV
NDQGLEGIGIAAEISRSVQKILPPEALIKAIRQTVAEAYQEAPSVVVLLNPGALPKTSSG
KVQRAACALRHADGSLDSYAQFPDLHVQVSDAALGCELQNQIAAIWCEQLHVATVAADDH
FFLLGGNSITATQVVARLRETLGLELNLRMLFEAPTLEGFAANVAQLQQDGGVAQGAIQP
LSRQEDLPQSLAQNRLWITWQLDPHSSAYTIPGALRLRGELDEDAVRLSFQHLVQRHEAL
RTRFYERDGQAFQRVEAKADFELQVIDLSDLPTDEREARAQQIREDEARTQFDLEKGPLL
WVTLVRLDDEDHQLLVTLHHIIADGWSLNILIDEFSRLYAAAAQGQTLELPPLALQYADY
GSWQRQWLAEGEGQRQLAYWKAQLGEEHPTLSLATDHPRSAHHRHTASRHTVRLGVSLSE
AIRQTAQAHESTPFMLLLAAFQSLLYRYSGQRNIRIGVPNANRPRQETQGLVGFFINTQV
MRAELDGRLPFSELLAATRQTALGAQAHQDLPFEQLLEAFPQAREQGLFQVMFNHQQRDL
SALRRLPGMLADELPWHSRDAKFDLQLHSEEDRNGRLSLSFDYADELFDSATVQRLAEHF
INLLQAACDQPQQAIGDLKLMQEDEQQPWSEAPCTPAQQWLPELLNRHTSDNIALVWQGG
SLTFAQLHTQANRLAHYLRDKGVGPDVCVAIAAERSPHLLIGLLAIIKAGGAYVPLDPDY
PAERLAYMLKDSGVHLLLTQTALLEQVPSADGVCVIAMDSLHLDSWPTQPPGLHLHGDNL
AYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYQLNDTDVLLQKAPISFDVSVWECFWP
LITGCRLVLAGPGEHRDPHRIAQLVQAHGVTTLHFVPPLLQLFIDEPRVTECTSLRRLFS
GGEALPAELRNRVLAQLPAVQLHNRYGPTETAINVTHWHCRAEDGERSPIGRPLGNVICR
VLDEQLNPVPLGVPGELCIGGIGLARGYLGRAGLTAERFVADPYGEAGARLYRTGDRARF
NAEGVIEYLGRLDQQVKLRGFRVEPEEIEARMLALEGIAQAVVLVRDAQLIGYYTALAQL
DEHHVKSALAAELPEYMVPALLMRLDAMPLSPSGKLDRRALPEPVWHVREHVEPETPLQQ
QIAAIWREVLGLPSIGLRDDFFALGGHSLLATQIISRTRQACDVELPLRTLFEASELGAF
AEQVGLIQASGQRNQQTAIAKVDRSQPVPLSYSQQRMWFLWQMEPDSPAYNVGGMARLRG
VLDVGRFEAALQALIMRHETLRTTFPSVDGVACQKVSAQTGLRMDWQDFSALDEAERQSR
LQQLADHEAHTPFNLETGPLLRACLVKAAEREHYLVLTLHHIVTEGWAMDIFARELSALY
EAFIDERLSPLAPLPVQYLDYSVWQRQWMEAGERQRQLDYWTQQLGTEHPLLELPGDRPR
PPVQSHRGELYRFDLSDDLAARVRAFNAERGLTLFMTMTATLAVLLYRYSGQTDLRIGAP
VANRIRPESEGLIGAFLNTQVLRCQLSGQMNVAELFEQVRHTVIEGQSHQDLPFDHLVEA
LQPPRSAAYNPLFQVMCNVQRWEFQQSRQLAGMTVEYLANDARATKFDLNLEVTDLDHRL
GCCLTYSTDLFDEPRIARMAEHWRNLLEALIANPQQRLSELPLLTAAEQRALQDSLGIEA
GEHRLDQCIHQLFSQQAAARGDAPALTFAGETLSYRELDARANRLAWMLRERGVGPQVRV
GLALPRSLEMVIGLLAILKAGGAYVPLDPEYPLDRLHYMIEDGGVGLLLSDAAMFEALGE
LPASVACWCLEDDLPVLANYPADEPPFISLPQHQAYLIYTSGSTGKPKGVVVSHGEIAMH
CAAVIERFGMRPDDCELHFYSINFDAATERLLVPLLSGAQVVLRAQGQWDAEEICALIRT
HRINILGFTPSYGSQLAQWLATQQQTLPVRMCITGGEALTGEHLQRIRAAFQPQVFFNAY
GPTETVVMPLASLAPEQLEEGAASVPIGSIIGDRVAYILDADLALVPQGATGELYVGGAG
LAQGYHQRPGMTAERFVADPFAHNGGRLYRTGDLVRQRADGLVEYLGRIDHQVKIRGFRI
ELGEIETRLLEHAAVREAVVLALDAPSGKQLVAYLVSDAEHGALRDALKAHLKAQLPDYM
VPAHLIVLDSMPLTANGKLDRRALPQPDPEANRQQYVAPRNELESTLAAIWCAVLNVQQV
GLDDNFFELGGDSILSIQVVSRARQAGIHFSPRDLFQHQTVQTLAAVATRSEQVTAEQGV
LTGTSGLTPIQHWFFDTDIPQRQHWNQALVLKPLQLLVPHRLEQALLAVLEHHDALRLSF
SQRDAHWHAEHLAVPQGGVLMQAQVRDMAQCTALFTDTQRSLDLQHGPLLRALLVDGPEG
QQRLLVAIHHLVVDGVSWRVLLEDLQTVYRQLSDGQSVSLPAKTSALREWAARLQAYAGS
ESLREELSVWQAQLAGPDVALPVARPQGSLRNRDADTVSVRLDAEHTRQLLQQAPSAYRT
QVNDLLLTALARVLCRWSGHASALIQLEGHGRESLFDDIDLTRSVGWFTSAYPLRLTPHA
AQGDSIKAIKEQLRSVPHKGLGYGVLRYLADDLCQQSMAVLPSAQITFNYLGQFDQSFGA
DALFHPLDESAGLAHDPDAPLPNELSVDSQVYGGELVLRWTLSRERFDHATVRELAEAYL
AELHSLTQHCLQDDAGGLTPSDFPLAHLSQVQLDSLPVPATVIEDVYPLTPMQEGLLLHT
LLEPGTGLYYMQDRYRINSALDPERFAQAWQAVIARHEALRASFCWNVGEDMLQVIHKPG
STPIEYLDWSADPESEQEPRLQALLKQEREVGFDLLNQAPFHLRLIRVGAERYWFMMSNH
HILIDAWCRSLLMNDFFEIYMALGEGREAQLATPPRYRDYIAWLQRQNLNEARQWWQQNL
QGFERTTPIPSDRPFLREHAGHSGGMVVGDCYTRLDACDGAQLRELAQAHQLTVNTFAQA
AWALVLRRLSGDRDVLFGVTVAGRPVEMPEMQRTVGLFINSIALRVKLPEDDQPCSVRQW
LSGLLDSNMQLREYEYLPLVTIQEHSELPKGQPLFDSLFVFENAPVEVSVLDRAHSLNAT
SDSGRTHTNFPLTAVCYPGDDLGLHLSYDQRYFDETTVQGMLGEFKRLLLALVQGFHGDM
ADLPLIGEQEREFLVDGCNQSEHDYPLERSYIELFEEQVAAHPQRIAASCLDQQWTYDEL
NRRSNGLGHALIAAGVGLDQPVALLAERNLDLLGMIIGSFKAGAGYLPLDPGLPSRRLRS
IIDLSRTPLLVCTEACREQAIELLDGFDCQLLVWEEIPARGENPGIYSGPDNLAYVIYTS
GSTGLPKGVMVEQRGMLNNQLSKVPYLALSDADVIAQTASQSFDISVWQFLAAPLFGARV
DVVPNTLAHDPQGLLEHVQAQGITVLESVPSLIQGMLAQDRISLDGLRWMLPTGEAMPPE
LAHQWLLRYPQIGLVNAYGPAECSDDVAFYRVDLASTRGTYLPIGTPTDNNRLYLLDGAL
ELVPQGAVGELCVAGTGVGRGYVSDPLRTAPVFVPNPFGAPGERLYRTGDLARRRSDGVL
EYVGRVDHQVKIRGYRIELGEIEARLHEQPEVRDAAVGVQEGVNGKHLVGYLVAADAALN
PGERLDRIKQRLRAELPEYMVPLHWLWLDRLPLNANGKLDRKALPALEIGQLHSQDYLAP
RNELETTLAAIWAEVLKVDRVGVQDNFFELGGHSLLATQIASRVQKTLQRDVPLRAMFEC
STVAELAEYIEGLAANEISAEKVDRLSDLMAELEGF
NT seq 12891 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgccttcgaacttccccaaacgctggtccactcccttcaacgtcgcgccgcg
cagactccggaccaggtcgccctgcgcttcctcgccgaatccgccgagcacagcgttgta
ctcagttaccgcgacctggacctgcgcgcccgcaccatcgccgccgccctgcaatccaat
gtggacctgggcgaccgtgcggtgctgttgttccccagcggcccggattacgtcgcggcg
ttctttggttgcctgtacgccggggtcattgcagtgccggcctatccgccggaatccacc
cgtcgccaccatcaggaacgcttgctgtcgatcatcagcgatgccgaaccgcgcctgttg
ctgaccatcgccagcctcgccgacggcctggcgcagattgaaaacgcgccgccagtattg
agcgtcgatagccttgagagtgccgacaactggatcgctcccgacctgcagccggacgac
atcgccttcctgcaatacacctccggttccaccgcgctgcccaagggcgtgcaagtcagc
catggcaacctggtggccaacgaagtgttgatccgtcgcggtttcggcatcgacctcaac
ccggatgacgtgatcgtcagctggctgccgctgtaccacgacatgggcctgatcggcggc
ctgctgcaaccgatcttcagtggcgtgccgtgcgtgctgatgtcgccggcctacttcctc
ggccggccgttgcgctggctcgaagcgatcagcgaatacggtggcaccatcagcggtggc
ccggatttcgcctatcgcctgtgcagcgagcgggtcagcgactcggcgctggaacgcctg
gacctgagccagtggcgcgtggcctattccggttccgaaccgatccgcctcgacaccctg
gaacgcttcgccgagaagttcgccacctgcggttttaccccgaacaatttctttgcctcc
tacggcctggccgaggcgaccctgtttgtcgccggtggcacgcggggccatggcatcccc
gcgctgcgggtcgacgagcaggccctggccgccaatcgcgccgaaccggggcagggcagt
gcaatcatgagctgtggcacccaccagcccgagcatgcggtcctgattgccgacccgcag
accctcaccgaactgcccgacaaccgcgtcggcgaactctgggccagcggcccaagcatc
gcccacggctactggcgcaaccccgaagccaccgccaagaccttcgtgcagcatgccggc
cgtacctggctgcgcaccggcgacctgggttttatccgtgacggcgaggtgtacatcacc
ggtcgcctcaaagacctgctgatcgtgcgcggccacaacctgtacccgcaggacatcgag
cagaccatcgagcgcgaagtggaagtcgtgcgcaaaggccgggtcgcggcatttgcagtg
aatgaccaaggcctggaaggtattggcattgccgccgaaatcagccgcagcgtgcagaaa
atcctgccgcccgaagcactgatcaaggcgatccgccaaaccgttgccgaggcgtaccag
gaggcgccgagcgtggtggtgctgctcaaccctggcgccctgccgaagacctccagcggc
aaggtgcaacgtgcggcgtgcgcgctgcggcatgccgatggcagcctcgacagctatgcg
cagttccctgatctgcacgtgcaggtcagcgatgcagcgttgggctgcgaactgcaaaac
cagatcgccgcgatctggtgcgagcaactgcacgtcgcgacggtcgcggccgatgaccat
ttcttcctgctcggcggcaactccatcaccgccacccaggtggtcgcgcgcctgcgtgaa
acactcggcctggagctgaacctgcgcatgctgttcgaagcgccaaccctggaaggcttt
gccgccaacgttgcgcagttgcaacaggatggcggtgttgcccaaggcgcgatccaaccc
ctgtcacgccaggaagacctgccccaatcccttgcacaaaaccgcctgtggatcacttgg
caactggacccccacagcagcgcctacaccatccccggcgccctgcgcctgcgcggcgag
ctggatgaagacgccgtgcgcttgagctttcaacacctggtccagcgccacgaagccctg
cgcacccgcttctacgaaagagacggccaggccttccagcgtgtcgaggccaaggcggat
ttcgagctgcaagtcatcgacctcagcgacctgcccactgacgaacgcgaagcccgtgca
cagcagatccgcgaagacgaagcccgtacccagttcgacctggaaaagggcccgctgctg
tgggtaaccctggtgcgcctggacgatgaggatcaccaactgttggtgacgctgcaccac
atcatcgctgacggctggtcgctcaacatcctcatcgacgaattctcgcgcctctacgcc
gccgccgcccagggccaaaccctggagctgccaccgctggccctgcaatacgccgactac
ggcagttggcagcgccaatggctggccgaaggcgaaggccagcgccaactggcgtactgg
aaagcgcagttgggtgaagagcatcccaccctgagcctggccaccgaccacccgcgctcg
gcacaccaccgtcacacagcttcacgccacacggtacgtcttggtgtgagcctcagcgaa
gcgattcgccagaccgcccaggcccacgaatccacacccttcatgctgttgctggcagcc
ttccagagcctgctctaccgctacagtggccagcgcaatatccgcatcggcgtgcccaac
gccaaccgtccgcgccaggaaacccaaggcctggtcggcttcttcatcaacacgcaggtc
atgcgggccgagctggacgggcgcctgccgttcagcgagctgttggccgcgacacgccag
acggcattgggcgcccaggcccatcaggacctgcccttcgaacagttgctggaagctttc
ccgcaagctcgcgaacagggcctgtttcaggtcatgttcaaccaccagcaacgcgacctc
agcgccttgcgccgtctaccgggcatgctcgccgacgaactgccatggcacagccgtgac
gccaagttcgacctgcaattgcacagcgaagaagaccgcaacgggcgcctgagcctgtcg
ttcgactacgccgacgagctgttcgacagcgcgaccgtccagcgcttggccgagcacttc
atcaacctgttgcaagccgcgtgtgaccagccgcagcaagccatcggcgatctaaagctg
atgcaggaagacgagcagcagccgtggagcgaagcaccttgcacacctgcccagcaatgg
ctgccggagctgctcaataggcacacctcggacaacatcgcgctggtctggcagggcggc
agcctgaccttcgcccaactgcacacccaggccaaccgcctggcccactacctgcgcgac
aaaggtgtcggcccggacgtgtgcgtggccatcgccgccgagcgctcgccgcacctcctg
atcggcctgctggcgatcatcaaggccggtggcgcctacgtgccgctggacccggattac
cccgccgagcgcctggcctacatgcttaaagacagtggcgtccacctgctgctgacccag
accgcattgctggaacaggtgccgagcgccgacggcgtgtgcgtgattgcgatggacagc
ctgcacctcgacagctggcccacccagccacccggcttgcacctgcacggcgataacctc
gcctacgtgatctacacctccggctccaccggccagcccaaaggcgtgggcaacacgcat
gcggcattggccgagcgcttgcagtggatgcaggccacctatcaactcaacgacaccgat
gtgctgctgcaaaaggcgccgatcagtttcgacgtgtcggtgtgggaatgcttctggccg
ctgatcaccggctgccgactggtactcgccggccctggtgaacatcgcgacccgcatcgc
attgcgcagttggtgcaggcacacggcgtgaccacgctgcactttgtgccgccgctgttg
cagttgtttatcgacgaaccgcgggtgactgaatgcaccagcctgcgccgcctgttctcc
ggcggcgaagccttgcccgccgaactgcgcaaccgcgtcctggcgcagttgccggcggtg
caattgcacaaccgttatggtccgaccgaaaccgcgatcaacgtgacccactggcactgt
cgcgcggaagacggcgagcgctcgccgattgggcgtccgttgggcaatgtgatctgccgc
gtgctggacgagcaactcaaccccgtgccactgggtgtgccgggtgaattgtgcatcggc
ggcattggcctggcccggggttacctcggccgcgcggggttgacggctgaacgcttcgtc
gccgacccctatggtgaggcgggcgcgcgcctgtaccgcaccggtgaccgcgcccgtttc
aacgccgagggtgtgatcgagtaccttgggcgcctcgaccagcaggtcaagctgcgtggc
ttccgtgtggagccggaagaaatcgaagcgcgcatgcttgccctggagggcatcgcccaa
gccgtggtgctggtgcgtgatgcacagctgatcggctactacaccgcccttgcccagctg
gacgaacaccacgtcaagagcgccctggccgccgagctgccggaatacatggtgcccgcg
ctattgatgcgcctggacgccatgcccctgagccccagcggcaagctggaccgtcgcgcg
ctgccggagccggtgtggcacgtgcgtgaacatgtcgagcccgagaccccgctgcaacag
cagatcgccgccatctggcgcgaagtcctcggcttgcccagcatcggcctgcgcgatgac
ttcttcgcccttggcggccactcgttgctggccacgcaaatcatctcccgcacccgccag
gcgtgtgacgtcgaactgccgttacggaccttgtttgaagccagcgagttgggcgctttt
gccgagcaggtcggcctgatccaggcgtcgggccaacgcaaccaacagaccgccatcgcc
aaggtcgaccgcagccaaccggtgccgctgtcctattcccagcagcgcatgtggttcctg
tggcagatggaaccggacagtccggcctacaacgtcggcggtatggcgcgcctgcgtggc
gtgctggatgtggggcgtttcgaggcggcgctgcaggccttgatcatgcgtcacgaaacc
ctgcgcaccacgttcccgagtgtcgacggcgtggcctgtcagaaggtctcggcccagacc
ggcctgcgcatggactggcaggacttctccgcgctggacgaagccgagcgccagtcacgg
ttgcagcaattggcggatcacgaggcgcatacgccgttcaacctggaaaccgggccgtta
ctgcgagcctgtctggtcaaggccgccgagcgcgagcactacctggtgctgaccctgcac
cacatcgtcaccgaaggctgggccatggacatctttgcccgtgaactcagcgcgttgtat
gaagcctttatcgacgagcgcctgtcaccgctggcgccgctgccggtgcagtacctcgat
tacagcgtgtggcaacgccagtggatggaagcgggtgagcgtcagcgtcagttggactat
tggacccagcagctgggtacggaacatccgttgctggaactgcccggcgaccgcccacgt
ccgccggtacaaagccatcggggcgagctgtaccgcttcgacttgagcgatgacctggcg
gcccgcgtgcgggccttcaacgccgaacgtggcctgaccctgttcatgaccatgaccgcc
accctggccgtgttgctctaccgctacagcggccagaccgacctgcgcatcggtgcccct
gtggccaaccgcattcgcccggaaagcgaagggctgatcggcgctttcctcaatacccag
gtgctgcgttgccagctcagtgggcagatgaatgtcgctgagttgttcgaacaggtgcgc
cacaccgtcatcgaaggccagtcccaccaggacctgccgttcgatcacctggtggaagcc
ctgcagccgccgcgcagtgcggcgtacaacccgctgttccaagtgatgtgcaatgtgcag
cgctgggagttccagcagagccgccaactggccggcatgaccgtcgagtacctggccaac
gatgcgcgcgcgaccaagttcgacctcaacctggaggtcaccgacctcgatcatcgcctg
ggctgctgcctgacctacagcaccgatctgttcgacgagccgcgcattgcgcgcatggcc
gaacattggcgcaacctgttggaagccttgatcgccaacccgcaacaacgcctcagcgaa
ctgccgttgctgaccgccgccgagcaacgcgccttgcaggacagcctgggcatcgaggcg
ggcgagcaccgtctcgaccagtgcattcatcaactgttcagccagcaagcggcagcccgt
ggcgatgcgccggcgctgacctttgccggtgaaaccctgagctaccgcgaactcgacgcc
cgcgccaaccgcctggcctggatgctgcgcgagcgtggcgtcggaccgcaggtgcgcgtg
ggcctggcgctgccgcgctcgctggaaatggtgatcggcctgctggcgatcctcaaggcc
ggcggcgcctatgtgccgctggacccggaatacccgctggaccgtctgcactacatgatc
gaagacggtggcgtcggcctgctgctcagcgatgcggcgatgttcgaagccctcggcgaa
ttgcccgcgagcgtggcgtgctggtgcctggaagatgacctgccggtgctcgccaactac
ccggccgatgagccgccctttatcagcctgccgcagcaccaggcgtacttgatctacacc
tccggctccaccggcaagccgaaaggcgtggtggtgtcccacggtgaaatcgccatgcat
tgcgcggcggtgatcgagcgctttggcatgcgccctgatgactgcgagttgcacttctat
tcgatcaacttcgacgctgccaccgaacgcttgctggtgccgctgctcagcggcgcccag
gtggtgttgcgggctcagggccagtgggatgcagaagaaatctgcgcgctgatccgcacc
catcgcatcaacatcctaggcttcacgcccagctatggcagccagttggcgcaatggttg
gcgacccagcagcagaccttgccggtgcgcatgtgcatcaccggtggcgaagcgctcact
ggcgaacaccttcagcgcatccgcgccgcgttccagccgcaggtgtttttcaacgcctac
ggcccgacggaaacggtggtgatgccgctggccagcctcgcgcccgagcagttggaggag
ggcgctgcgagcgtgccgatcggcagcattatcggtgaccgcgtggcctatattctcgat
gccgacctggcgttggtgccgcaaggcgcgaccggcgagttgtacgtcggtggggcgggt
ctcgcccagggttatcaccagcgtccgggcatgaccgccgagcggtttgtcgccgacccg
tttgcccacaatggcgggcgcctgtaccgcaccggcgacctggtgcgccaacgcgccgat
ggcctggtggagtacctggggcgtatcgaccaccaggtgaagattcgcggtttccgtatt
gaactgggcgagatcgaaacccgcctgttggaacacgcggccgtgcgcgaagccgtggtg
ctggcgctggatgcgccgagtggcaaacagttggtggcgtacctggtcagcgatgccgag
cacggcgcattacgcgatgcgctcaaggctcacctcaaggcgcaactgccggactacatg
gtgcccgcgcacctgattgtgctcgacagcatgccgctgaccgccaacggcaaactcgac
cgtcgcgccttgccgcagccggacccggaagccaaccgccaacaatacgtggccccgcgc
aacgaacttgaaagcacgttggccgccatctggtgcgctgtgttgaatgtgcagcaagtc
ggtctcgacgataacttctttgagctgggcggcgactcgatcctgtcgatccaggtggtc
agccgtgcgcggcaggccgggattcacttcagcccccgcgacctgttccagcaccagacc
gtgcaaaccctggcggcggtcgccacgcgctccgagcaggtcacggccgagcagggtgtg
ttgaccggcacctccgggctgacgccgatccagcactggttcttcgacactgatatccca
cagcgccaacactggaaccaggcactggtcctcaagccgttgcaactgctggtgccgcat
cgcctggagcaagccttgctggcggtgctggaacaccacgacgccctgcgcctgagcttc
tcccagcgtgacgcgcactggcatgccgagcacctggccgtgccgcaaggcggcgtactg
atgcaggcgcaagtgcgcgatatggcgcaatgcaccgcgctgttcaccgacacccaacgc
agcctcgacctgcaacacggcccgctgctgcgcgccttgctggtggacgggcccgagggg
cagcaacgcctgctggtcgcgatccatcacctggtggtggacggcgtgtcgtggcgggtc
ttgctggaagatttgcaaacggtttaccgccagttgagcgacggccagtccgtcagcctg
ccggccaagaccagtgccctgcgtgagtgggccgcgcgtttgcaggcctacgccggcagt
gaatccctgcgtgaagaattgagcgtctggcaagcgcagttggcgggccctgatgtggcg
ttgccggtggcccgcccgcaaggttcgctgcgcaaccgcgatgccgacaccgtcagcgtg
cgcctggatgccgagcatacgcgtcagctattgcaacaggctccgagcgcctaccgcacc
caggtcaacgatctgctgctgacggccttggcccgtgtgctgtgccgctggagcggccac
gcgtcggcgctgatccagttggaaggccacggccgcgaaagcctgttcgatgacatcgac
ctgacccgcagcgtcggctggttcaccagcgcctacccgctgcgcctcactccgcacgct
gctcagggcgactcgatcaaggcgatcaaggaacaactgcgctccgtaccgcataaaggc
ttgggctacggcgtgctgcgctacttggccgatgatctgtgccaacagagcatggccgtc
ttgccgagcgcgcagatcaccttcaactacctcggccagttcgaccagagcttcggcgcc
gatgcgctgttccacccattggatgaatccgcaggcctggcccatgacccggacgcgccg
ctgcctaacgagttgagcgtcgacagccaggtctacggcggcgagttggtgctgcgctgg
accttaagccgtgaacgcttcgatcacgctaccgtgcgcgaattggccgaggcgtatctg
gccgaactgcacagcctgacccagcactgcctgcaggacgatgccggtggccttacgccg
tccgacttcccgctggcccacctgagccaggtgcaactcgacagcttgccggtaccggcc
accgttatcgaagacgtctacccgctgaccccgatgcaggaaggcctgttgctgcatacc
ctgctggagccgggcaccggcctctactacatgcaggaccgctaccgcatcaacagcgcc
ctggaccccgagcgtttcgcccaggcctggcaggcggtgatcgctcgtcacgaagccctg
cgtgcctcgttctgctggaacgtcggcgaagacatgctgcaagtgatccacaaaccgggc
agcacgccgatcgagtatctggactggagtgctgacccggaaagcgaacaggaaccgcgc
ctgcaagcgctgctcaagcaagagcgcgaagtcggttttgatctgctcaaccaggcaccg
ttccacctgcgcctgatccgtgttggcgccgaacgctactggttcatgatgagcaaccac
cacatcctcatcgatgcttggtgccgttcgttgttgatgaatgacttcttcgagatctac
atggccctcggtgaaggccgcgaagcgcaactggccacaccgccgcgttatcgcgactac
atcgcctggctgcaacgccagaacctcaacgaggctcgccagtggtggcagcagaacctg
caagggttcgagcgcaccacgccgatcccgagcgaccggccgttcctgcgtgagcacgcg
ggtcacagcggcggcatggtggtgggcgattgctacacccgtctcgacgcctgcgatgga
gcacaactgcgcgaactggcccaggcccatcagctgaccgtcaacactttcgcccaggcg
gcgtgggcgctggtgctgcggcgcctgagcggtgatcgcgacgtgctgttcggcgtcacc
gtggccgggcgcccggtggagatgcccgaaatgcaacgcaccgtcggcctgttcatcaac
agcatcgcgctgcgggtaaaactgcccgaggacgaccagccttgcagcgtgcgccagtgg
ttgagcggcctgctcgacagcaatatgcaactgcgcgagtacgaatacctgccgctggtg
acgatccaggaacacagcgaactgcccaagggccagccgctgttcgacagcctgttcgtg
ttcgaaaatgccccggtggaagtctcggtgctggaccgcgcgcacagcctgaatgccacc
tcggactccggccgcacccacaccaacttcccgctgaccgccgtgtgttatccgggcgat
gacctcggtttgcacctgtcctacgaccaacgctacttcgacgaaaccaccgtgcaaggc
atgcttggcgagttcaagcgcctgctgctggcgctggtgcagggcttccacggcgacatg
gccgacctgccgctgattggcgagcaggagcgcgagttcctggtggatggttgtaaccag
agcgaacacgactacccgctggagcgcagctacatcgagctgttcgaagagcaggtggcc
gcgcatccgcagcgcatcgccgccagttgcctcgaccagcaatggacctatgacgaactg
aaccgtcgcagcaacggcctcggccacgcgctcatcgcagcgggtgtcggcctcgatcaa
ccggtggcgctactcgccgaacgcaacctcgacctgctgggcatgatcatcggcagcttc
aaggccggtgccggctacctgccgctcgacccgggcctgccgagccgccgtttgcgcagc
atcatcgacttgagccgcacgccgttgctggtgtgcaccgaggcgtgccgcgagcaggcc
atcgagttgctggacggtttcgactgccagctgctggtgtgggaagaaataccggcgcgt
ggcgaaaaccctgggatctacagcggcccggacaacctcgcctatgtgatctatacctcg
ggctccaccggcctgcccaagggtgtgatggtggaacagcgcggcatgctcaataaccag
ttgagcaaggtgccatacctggccttgagcgacgcggatgtgattgcgcaaaccgcttcg
cagagcttcgacatttccgtgtggcaattcctcgccgcgccgctgttcggcgcacgggtg
gatgtcgtgccgaacaccctcgcccacgatccacagggcctgctggaacatgtgcaggcc
cagggcatcaccgtgctggaaagcgtaccgtcgctgatccagggtatgttggcccaggac
cgtatcagcctggacggcctgcgttggatgctgccgaccggtgaagccatgccgccggaa
ctggcgcaccaatggctgctgcgctacccgcagataggtttggtgaacgcgtatggcccg
gcggaatgctcggacgatgtggcgttttaccgcgtcgacctggcctcgacccgtggcact
tacctgccgattggcacgccgaccgacaacaatcgtttgtacctgctcgatggtgcgttg
gagctggtgccgcaaggtgctgtcggcgagttgtgtgtcgccgggaccggcgtcggtcgc
ggttacgtcagcgacccgctgcgcaccgcgccggtgtttgtgcccaacccgttcggtgcc
cccggcgaacgcctctaccgcaccggtgacctggcgcgccgccgcagtgacggtgtgctg
gagtatgttggtcgcgtcgaccaccaggtgaagattcgcggctaccgcatcgaactgggt
gaaatcgaagcgcgcctgcacgaacaaccggaagtgcgcgatgcggcggtgggcgtgcag
gaaggcgtcaacggcaagcatctggtcggctatctggtggccgcggatgcagcactgaac
ccaggcgagcgcctggaccgcatcaagcaacgcctgcgggccgaactgccggaatacatg
gtgccgctgcactggctatggctcgaccgcctgccgctcaacgccaacggcaaactcgac
cgcaaggccctgccggcgctggagatcggccagttgcacagccaggactacctggcgccg
cgcaacgaactggaaaccaccctggccgctatctgggccgaggtgctgaaagtcgatagg
gtaggggtgcaggacaacttctttgaactgggcgggcattcgttgctggccacgcagatt
gcctcgcgggtgcagaaaaccctgcaacgggatgtgccgctgcgggcgatgttcgagtgc
agcacggtggcggagttggctgagtatatcgaggggttggcggcgaatgagatcagtgcc
gagaaggtggatcggttgagtgatttgatggcggagttggaggggttttga

DBGET integrated database retrieval system