KEGG   Pseudomonas fluorescens SBW25: PFLU_5529Help
Entry
PFLU_5529         CDS       T00899                                 

Gene name
tufB
Definition
(GenBank) elongation factor TU
  KO
K02358  elongation factor Tu
Organism
pfs  Pseudomonas fluorescens SBW25
Brite
Translation factors [BR:pfs03012]
 Eukaryotic Type
  Elongation factors
   PFLU_5529 (tufB)
 Prokaryotic Type
   PFLU_5529 (tufB)
Mitochondrial biogenesis [BR:pfs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PFLU_5529 (tufB)
Exosome [BR:pfs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PFLU_5529 (tufB)
  Exosomal proteins of breast cancer cells
   PFLU_5529 (tufB)
  Exosomal proteins of colorectal cancer cells
   PFLU_5529 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CAY52770
UniProt: C3K2X8
LinkDB All DBs
Position
complement(6049079..6050272)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAIVDFDKIDSAPEEKARG
ITINTAHVEYNSLIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVYLNKADLVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSARMALE
GKDDNEMGTTSVRKLVETLDSYIPDPVRVIDKPFLMPIEDVFSISGRGTVVTGRIERGIV
KVQDPLEIVGLRDTTVTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
SVKPHTKFEAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
KMVVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaagaaaaatttgatcgttccctaccgcacgtcaacgttggcactatcggtcac
gttgaccacggtaaaaccactctgactgctgctctgactcgcgtttgctccgaagtattc
ggttctgcaatcgttgatttcgataaaatcgacagcgcaccagaagagaaagctcgtggt
atcaccatcaacaccgcgcacgttgaatacaactcgctgatccgtcactacgctcacgtt
gactgcccaggtcacgctgactatgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggccgctgatggtccgatgccacaaacccgtgagcacatc
ctgctgtcccgtcaggtaggcgttccgtacatcgtggtttacctgaacaaggctgacctg
gtagacgacgctgagctgctggaactggttgagatggaagtgcgcgatctgctgagcact
tacgacttcccaggcgacgacactccgatcatcatcggttctgctcgtatggctctggaa
ggcaaagacgacaacgaaatgggcaccacgtccgttcgtaaactggttgagactctggac
agctacatcccagatccagtccgtgttatcgacaagccgttcctgatgccaatcgaagac
gtattctcgatctccggtcgtggtactgttgtgactggtcgtatcgagcgcggtatcgtt
aaggttcaagatccactggaaatcgttggtctgcgtgacactaccgtcaccacctgcacc
ggtgttgaaatgttccgtaagctgctcgacgaaggtcgtgctggcgagaactgcggcgtt
ctgctgcgtggtaccaagcgtgacgacgttgagcgtggccaggttctggtcaagccaggt
tcggttaagccgcacaccaagttcgaagctgaagtgtacgtgctgagcaaagaagaaggc
ggtcgccacactccgttcttcaaaggctaccgtccacagttctacttccgtactactgac
gtgactggtaactgcgagctgccggaaggcgttgaaatggtaatgccaggcgacaacatc
aaaatggttgtcaccctgatcaaaaccatcgcaatggaagacggtctgcgtttcgctatc
cgcgaaggtggccgtaccgttggtgctggtgttgtagctaaaatcatcgagtaa

DBGET integrated database retrieval system