KEGG   Pyrococcus furiosus DSM 3638: PF0353Help
Entry
PF0353            CDS       T00075                                 

Definition
(GenBank) hypothetical protein
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Brite
Enzymes [BR:pfu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PF0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AAL80477
UniProt: Q8U3V2
LinkDB All DBs
Position
complement(365787..366926)
Genome map
AA seq 379 aa AA seqDB search
MVSSKFKELLYTLGIPEDKVEILEARGGIMEDEFEGIRYLRFKNSVGKLRRGTVLFEDGT
TVFGFPHIKRIVNLSAGVRKIFKSSEFYVEEKVDGYNVRVVKFKDRILGITRGGFICPYT
TERIAEFVPEEFFKDHKDLVLVGEMAGPESPYLVEGPPYVKEDIQFFLFDIQDIKTGSSL
PVEERLKLAEEYGINHVEVFGRYSYKDIDDLYELIERLSREGREGIVMKSPDMKKIVKYV
TPYANINDIKIGARVFYELPGGYFTSRISRLAFYIAEKKIRGEELHNLALQLGKALLQPL
VEAIHDVTQGDVIAERFRVRVRKIETAYKMVTHFEKLGLEIEIEDIEEIEGGWRVTFKRV
YPEATREIRDLIGGKAFVD
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggtaagctcgaagtttaaggagctcctttataccctgggaattcccgaagataaagta
gagattcttgaagctaggggcggaattatggaggatgagtttgaaggcattagatatctt
aggtttaagaattcagttggaaaactgaggaggggaactgtactttttgaagacgggaca
actgtttttggctttcctcacatcaagaggattgtaaacctttcagctggagttagaaaa
atctttaagtcctctgagttctacgttgaggagaaagttgatgggtacaatgttagagtt
gtgaagttcaaagataggattctcggaataactaggggaggatttatttgtccttacact
accgaaagaattgctgaattcgttccagaagaattctttaaagatcataaggatttggta
ttagttggggaaatggcaggccctgaaagtccctatttggtggaaggacctccatatgta
aaagaggacatacaattcttcctatttgatatacaggacatcaaaacaggtagtagtttg
cctgtagaggagaggctcaagctcgccgaggagtatggaataaatcacgtggaagtcttt
gggaggtattcctataaggacatagatgatctttatgagctaattgagaggctcagcagg
gaaggaagagaaggaatagttatgaaaagtccagacatgaagaaaattgtaaagtacgtg
acaccttatgcgaatattaacgatataaaaataggggcaagagtattttacgagcttcct
ggggggtacttcacgagcagaatttcgaggttagccttctacatagcggaaaagaaaatt
aggggggaagaactccataacttggcattgcaacttgggaaagctctgcttcaacctctt
gttgaggccattcacgacgttacccagggagatgtaattgcagagagattcagagttaga
gttagaaaaattgagacagcatataagatggtaacacactttgaaaaactagggttggaa
atagagatagaggatattgaggagatagagggaggatggagagttacattcaagagagtt
tatcctgaagctacaagagaaataagagacctcataggggggaaggcattcgttgattaa

DBGET integrated database retrieval system